(data stored in ACNUC7421 zone)

EMBL: CR954246.GSPF

CR954246.GSPF        Location/Qualifiers
FT   CDS_pept        249428..250663
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gspF"
FT                   /locus_tag="PSHAa0234"
FT                   /product="putative general secretion pathway protein F"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homolgy; Product type t : transporter"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0234"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85337"
FT                   /db_xref="GOA:Q3ILN8"
FT                   /db_xref="InterPro:IPR001992"
FT                   /db_xref="InterPro:IPR003004"
FT                   /db_xref="InterPro:IPR011850"
FT                   /db_xref="InterPro:IPR018076"
FT                   /db_xref="InterPro:IPR042094"
FT                   /db_xref="UniProtKB/TrEMBL:Q3ILN8"
FT                   /protein_id="CAI85337.1"
FT                   /translation="MAAFEYRALDGRGKEKKGILEADTAKQIRQILRDQKLTPLEVVPA
FT                   AQSDKQVKGQKTSLLGGLFKPTISTSDLALITRQLATLIQSALPVEGAVMAVAEQCEKP
FT                   RLKRMLMSVRSKVVEGYTLADGMSEFPHVFDDLYRAMVAAGEKSGHLDQVLNRLADYTE
FT                   QRQYMRSQITQAMVYPIILVVFAIAIVSVLLGTVVPKILKTFEKTKQVLPWTTEWVMAG
FT                   SHFVQNYWFISLIVITALAIGIKHALKQPKIRFWWDDKILHMPGIGKVARGINTARFAR
FT                   TLSILSSSSVPLLEGMRIAGGVLINEKIKKAVADAADRVSEGASLRAALQQTKLFPPMM
FT                   LHMIASGEKSGELEQMLERAANNQDREFESMVNVSLKLLEPAMIALMAVIVLFIVMAIL
FT                   QPIMAMNKAVGL"
     atggcagcat ttgaataccg tgccctagat ggccgaggca aagaaaaaaa aggcatttta        60
     gaagcggata cagcaaaaca aattcgccaa atattacgcg atcaaaaatt aacgccgctc       120
     gaagttgtac ccgcggcgca aagtgataaa caggttaaag gccaaaaaac gtcattactt       180
     ggcggtttgt ttaaacctac tatatcaacc tcagatttgg cgcttataac tcgccagtta       240
     gcaacactca ttcaatcggc tctgccagtt gagggtgcgg taatggctgt ggctgagcaa       300
     tgtgaaaaac cacgtttaaa acgcatgctg atgtcggttc gctcaaaagt agtggaaggg       360
     tatacccttg ccgacggtat gagtgagttt ccgcatgtgt ttgacgattt ataccgcgct       420
     atggttgccg caggcgaaaa gtcagggcat ttagaccaag tactaaaccg gcttgccgat       480
     tacaccgagc agcgccaata tatgcgcagt caaataacac aagctatggt gtaccccatt       540
     attttagtgg tgtttgctat tgcaattgtg tcggttttat taggtactgt agtacctaaa       600
     atacttaaaa cgtttgaaaa aaccaagcaa gtactccctt ggaccactga gtgggtaatg       660
     gcgggaagtc attttgtaca aaattattgg tttattagtt taattgtaat aacggcccta       720
     gcgataggga ttaagcatgc tttaaaacag cctaaaattc gtttttggtg ggatgataaa       780
     atattgcata tgcccggtat tggtaaagta gctagaggta ttaataccgc tcgttttgcc       840
     cgaactttaa gtattttatc atcaagctcg gtaccgctac ttgaaggtat gcgtattgcg       900
     ggtggagtgc tgatcaacga aaaaattaaa aaagcagttg ccgatgcagc cgatagagta       960
     agcgaagggg caagtttaag agcggcatta cagcaaacta aattgtttcc gccaatgatg      1020
     ctacatatga tagccagtgg tgaaaaatct ggcgagctgg agcaaatgtt agaacgcgct      1080
     gctaataacc aggaccgcga atttgaaagt atggttaatg tatcgctaaa actattagaa      1140
     cccgcaatga tcgccttaat ggcggttatt gtattattta tagtaatggc aattttacag      1200
     ccaattatgg caatgaataa agctgtaggg ctttaa                                1236
//

If you have problems or comments...

PBIL Back to PBIL home page