(data stored in ACNUC7421 zone)

EMBL: CR954246.GSPG

CR954246.GSPG        Location/Qualifiers
FT   CDS_pept        250765..251151
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gspG"
FT                   /locus_tag="PSHAa0235"
FT                   /product="putative general secretion pathway protein G
FT                   [Precursor]"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homolgy; PubMedId : 7896718; Product type t : transporter"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0235"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85338"
FT                   /db_xref="GOA:Q3ILN7"
FT                   /db_xref="InterPro:IPR010054"
FT                   /db_xref="InterPro:IPR013545"
FT                   /db_xref="UniProtKB/TrEMBL:Q3ILN7"
FT                   /protein_id="CAI85338.1"
FT                   /translation="MVVLVIIGMIMSIVAPNIMGQQEEAAIDKAHLDIQQLEDAMSLYK
FT                   LKNKSYPSTEQGLEALVNKTSIEPIPKRFPDGGFISKLPEDPWGNTYQLISPGEIGKFD
FT                   IFSLGPDGQAGTDDDIGNWDEEKQ"
     atggtcgtac tggttatcat tggcatgatc atgtcaattg tggcacctaa tattatgggt        60
     caacaagaag aggccgctat cgataaagca cacttagata ttcagcagct tgaagatgca       120
     atgagccttt ataagcttaa aaataaaagc tacccaagta ccgagcaagg cctagaagca       180
     ttggttaata aaaccagcat agagccaata ccaaaacgtt ttccagatgg tggctttatt       240
     agtaaattac cagaggatcc gtggggcaat acttatcagt taattagccc aggagaaatt       300
     ggtaaatttg atattttttc tttaggtcca gatggccaag ccggcaccga tgacgacatt       360
     ggtaactggg acgaagaaaa acagtaa                                           387
//

If you have problems or comments...

PBIL Back to PBIL home page