(data stored in ACNUC7421 zone)

EMBL: CR954246.GSPH

CR954246.GSPH        Location/Qualifiers
FT   CDS_pept        251201..251785
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gspH"
FT                   /locus_tag="PSHAa0236"
FT                   /product="putative general secretion pathway protein H
FT                   precursor"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homolgy; PubMedId : 7896718; Product type t : transporter"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0236"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85339"
FT                   /db_xref="GOA:Q3ILN6"
FT                   /db_xref="InterPro:IPR002416"
FT                   /db_xref="InterPro:IPR012902"
FT                   /db_xref="UniProtKB/TrEMBL:Q3ILN6"
FT                   /protein_id="CAI85339.1"
FT                   /translation="MQVSSERLRAKSRGFSLIEILVVLVIIAFATKMVVYSLEGGAEDE
FT                   LDTQALRLHTTINMASEFAILNQVELGFHIDNNVFEFLVFDGEKWVSFVREALFEPVEF
FT                   DPRFKLALNLDDLAWAQDNLLEQANWRELMSGDEDSLLELKKFKIPQVLILSSGEVSAF
FT                   QLTLELKEQSEPVYFIEGEFTAPVNLRREPE"
     atgcaagtaa gctctgagag attgcgtgca aaaagccgcg gctttagttt aatcgaaatt        60
     ttagtggtat tagtgatcat cgcttttgcc acaaaaatgg tggtatatag cttagaaggc       120
     ggcgctgagg atgagttaga tactcaagcg cttaggctgc ataccaccat taatatggca       180
     tcagaatttg ctattttaaa ccaagttgaa ttgggttttc atatagacaa caacgtattt       240
     gagtttttag tttttgatgg tgaaaagtgg gtaagctttg tcagagaagc attatttgag       300
     ccggttgaat ttgatccacg ctttaaacta gcgcttaacc tagacgactt agcttgggcg       360
     caagataact tactcgagca agcaaattgg cgtgagctaa tgagcggaga cgaagacagc       420
     ttattggagc ttaaaaagtt taaaattccg caagtgctaa tactatcttc gggcgaagta       480
     agtgcatttc aattaacact cgaattaaaa gagcaaagcg agccggttta ctttattgaa       540
     ggcgagttta ctgcgccagt gaatttacgc cgagagcccg aataa                       585
//

If you have problems or comments...

PBIL Back to PBIL home page