(data stored in ACNUC7421 zone)

EMBL: CR954246.GSPI

CR954246.GSPI        Location/Qualifiers
FT   CDS_pept        251785..252162
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gspI"
FT                   /locus_tag="PSHAa0237"
FT                   /product="putative general secretion pathway protein I
FT                   [precursor]"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homolgy; Product type t : transporter"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0237"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85340"
FT                   /db_xref="GOA:Q3ILN5"
FT                   /db_xref="InterPro:IPR003413"
FT                   /db_xref="InterPro:IPR010052"
FT                   /db_xref="InterPro:IPR012902"
FT                   /db_xref="UniProtKB/TrEMBL:Q3ILN5"
FT                   /protein_id="CAI85340.1"
FT                   /translation="MRQYNKGFTLLEVLVALSICAMAGIAAMQATSEHIHHLSSIEEQT
FT                   YASWVAENIMVEQRTKGEQWEGKDGVRGSEVMAGVEWFWRQDIGKTADKDFVKLTINIF
FT                   SDEKYEHSVYELATYLNKGKK"
     atgcgccagt ataataaagg ttttacttta cttgaagtgc tagtggcatt gagtatttgt        60
     gctatggcag gtattgcagc aatgcaagca accagtgagc acattcatca tctatctagc       120
     atagaagagc aaacttacgc ctcatgggtt gccgaaaaca ttatggtaga gcagcgtacc       180
     aaaggcgaac aatgggaagg gaaagacggc gtgcgcggta gtgaagttat ggcgggtgtt       240
     gaatggtttt ggcgccaaga tataggcaaa accgcagata aagactttgt aaaattaacc       300
     attaatatat ttagtgatga aaaatacgag cactcggtat atgagctggc aacttattta       360
     aataaaggca aaaaataa                                                     378
//

If you have problems or comments...

PBIL Back to PBIL home page