(data stored in ACNUC7421 zone)

EMBL: CR954246.GSPJ

CR954246.GSPJ        Location/Qualifiers
FT   CDS_pept        252163..252837
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gspJ"
FT                   /locus_tag="PSHAa0238"
FT                   /product="putative general secretion pathway protein J
FT                   [Precursor]"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homolgy; Product type t : transporter"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0238"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85341"
FT                   /db_xref="GOA:Q3ILN4"
FT                   /db_xref="InterPro:IPR010055"
FT                   /db_xref="InterPro:IPR012902"
FT                   /db_xref="UniProtKB/TrEMBL:Q3ILN4"
FT                   /protein_id="CAI85341.1"
FT                   /translation="MKQRGFTLLEVMVALGILGFVIMATHQILDTTTRAKEASDDKIAE
FT                   LNGLQTTFRLMDQDFSQMTKRAVRNEAGDVQEQYLLAGRYVLDSQYDGIGFVRDGWINP
FT                   INLLPRSELQAVGYRVINDNLERVYRVYVDQLDNMEPRVQVVLKNIEELKFEFLDDKNE
FT                   WQAKWQIKALPKAVAVTLQQIEAEPIRRVFLVPGQGKEILPSSPSTDDALADEGNPQEG
FT                   GQ"
     gtgaagcaac gcggatttac cttacttgaa gtgatggtag ccttggggat tttaggcttt        60
     gttattatgg ccacgcacca aatactagat accactaccc gcgccaaaga ggcttcggat       120
     gataaaatag ccgagctaaa tggtttgcaa accaccttta ggttaatgga tcaagatttt       180
     agtcaaatga ccaaacgtgc tgtacgcaat gaagcaggcg atgtgcaaga gcagtatttg       240
     ctagccggac gctatgtttt agatagccaa tatgatggca ttggctttgt gcgcgacggc       300
     tggataaatc caattaattt attaccacgc tcagaattac aagctgtggg ttatcgcgta       360
     ataaacgaca acttggagcg agtgtaccgg gtatatgttg atcagcttga taatatggag       420
     ccgcgtgtac aggttgtttt aaaaaacatt gaagagctaa agtttgaatt tttagacgat       480
     aaaaacgaat ggcaagctaa gtggcaaatt aaagcacttc ctaaagcggt tgctgttacg       540
     ctgcaacaaa ttgaggcgga gccaattagg cgagtatttt tagtgccagg acaaggtaaa       600
     gaaattctac catcgagccc atcaactgat gatgcactgg ccgatgaagg taacccgcaa       660
     gaaggtgggc agtaa                                                        675
//

If you have problems or comments...

PBIL Back to PBIL home page