(data stored in ACNUC7421 zone)

EMBL: CR954246.GSPK

CR954246.GSPK        Location/Qualifiers
FT   CDS_pept        252837..253823
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gspK"
FT                   /locus_tag="PSHAa0239"
FT                   /product="putative general secretion pathway protein"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homolgy; Product type t : transporter"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0239"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85342"
FT                   /db_xref="GOA:Q3ILN3"
FT                   /db_xref="InterPro:IPR005628"
FT                   /db_xref="InterPro:IPR038072"
FT                   /db_xref="UniProtKB/TrEMBL:Q3ILN3"
FT                   /protein_id="CAI85342.1"
FT                   /translation="MGLRSSRGAALVIVLFIVALAAILAVEMSANLMVQVQKSTNLQGH
FT                   QQAKWYAYGAEELAIKALIKSKRDDPDKTTLDQIWAQQGDIPYPVDNGTLSGKITDLQA
FT                   CLNLNAIAVEPDLNSASKTNPAHKALFALLENIEDLPAQESEETMADSVFDWLDENSIT
FT                   YRSGAEEGEYLSRQFPYMTANSLFASTSELRLVKGFNPLVMEKVLPYVCVIPGSTLLSI
FT                   NVNTLAAEQALILSTLIDELSVSGAEAVIAARPDAGFESKAAFFEQVQQQGGQNVKAVE
FT                   KLFSINSEYFKLQTQANFVDLRFSMTTLLHAKDGDVTILARKFGGVQ"
     atggggctgc gttcttctcg tggagccgca cttgttattg tgctgtttat tgttgcatta        60
     gcggccattt tagccgtaga aatgagtgct aacttaatgg tgcaagtgca aaaaagtact       120
     aacttacagg gtcatcaaca agctaagtgg tatgcctatg gtgcagaaga gcttgccata       180
     aaagcgctga ttaaaagcaa aagagacgat cctgacaaaa ccacgttaga tcaaatatgg       240
     gcgcagcaag gcgatatacc ttacccagtt gataacggca cactaagcgg aaaaataacg       300
     gatttacaag catgtttaaa cttaaatgct atagccgtag aaccagattt aaatagtgct       360
     agcaaaacca atccagcgca caaggccttg ttcgcattac ttgaaaatat tgaagattta       420
     ccggcacaag agtcagagga aaccatggct gacagtgtgt ttgattggct agacgaaaac       480
     agcattacat accgttcagg agcagaagaa ggggaatact tgtcgcgtca atttccgtac       540
     atgaccgcca atagcttatt tgcatcaacc tcagagctgc gtttggttaa aggttttaac       600
     ccattagtaa tggaaaaagt gctgccttat gtttgtgtaa tacccggtag cactttattg       660
     tctattaatg tgaatacctt agcagcagag caagcactta ttttaagtac cctaatagat       720
     gagctaagtg tatcgggtgc tgaagctgtg attgctgctc gcccagatgc aggctttgaa       780
     agtaaagctg ccttttttga acaagttcag cagcaaggcg ggcaaaacgt caaagcggta       840
     gaaaaattgt ttagtattaa tagcgaatat tttaaattac aaacgcaggc aaactttgtt       900
     gatctgcgtt tttcgatgac cacattactg cacgccaaag acggcgacgt aacgatactg       960
     gcgcgaaaat ttggaggcgt acagtga                                           987
//

If you have problems or comments...

PBIL Back to PBIL home page