(data stored in ACNUC7421 zone)

EMBL: CR954246.GYRB

CR954246.GYRB        Location/Qualifiers
FT   CDS_pept        3782..6208
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gyrB"
FT                   /locus_tag="PSHAa0004"
FT                   /product="DNA gyrase, subunit B (type II topoisomerase)"
FT                   /function="3.1.3 : DNA packaging and segregation"
FT                   /function="3.2.1.1 : Regulation"
FT                   /EC_number="5.99.1.3"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 8982450, 11125132; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0004"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85118"
FT                   /db_xref="GOA:Q3IDE7"
FT                   /db_xref="InterPro:IPR001241"
FT                   /db_xref="InterPro:IPR002288"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR011557"
FT                   /db_xref="InterPro:IPR013506"
FT                   /db_xref="InterPro:IPR013759"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR018522"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR034160"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="InterPro:IPR041423"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IDE7"
FT                   /protein_id="CAI85118.1"
FT                   /translation="MSENYDSSSIKVLKGLDAVRKRPGMYIGDTDDGTGLHHMVFEVVD
FT                   NSIDEALAGHCDDIFVTIHLDGSVSVRDNGRGIPTSIHEEEGVSAAEVIMTVLHAGGKF
FT                   DDNSYKVSGGLHGVGVSVVNALSEKLKLTIRREGKLHEQTYSHGVPDAPLAVIGDADTT
FT                   GTELRFWPSDQTFTNLDFHYDILAKRLRELSFLNSGVSIILNDEREENKSDHFKYEGGI
FT                   RAFVEYLNRNKTPIHKGVFHFTHTREEDGIVVEVSMQWNDAYQENIYCFTNNIPQRDGG
FT                   THLAGFRSALTRTLNNYMEKEGFNKKAKTTSNATGDDAREGLTAVVSVKVPDPKFSSQT
FT                   KDKLVSSEVKSAVEQAMAEKFTEFLLEHPTDAKIVVGKIIDASRAREAARKAREMTRRK
FT                   GAMDLAGLPGKLADCQEKDPAQSELYIVEGDSAGGSAKQGRNRKNQAILPLKGKILNVE
FT                   KARFDKMLSSQEVATLITALGCGIGRDEYNPEKLRYHRIIIMTDADVDGSHIRTLLLTF
FT                   FYRQMPEIVERGYIYIAQPPLYKVKKGKQERYIKDDPALVEYLTTLALNNATLYTSTDA
FT                   SGIEGEALEKIVHDYQNTVKVIERLKRKFPNTVMNRLIYQSELKKEDLSDEAKVIAWTK
FT                   ELVDDLIDRDEDATIFQAATEHDTERNLYYPVVKIRQHGVDKAHVLHYDFIASRDYQRI
FT                   AVTGVNIANIITEGAYIQRGEKTQPVDNFVDALEWLIAESKRGLYIQRYKGLGEMNPSQ
FT                   LWETTMDPDARRMLQVTVEDAVAADQLFATLMGDQVEPRREFIEQNALRVVNLDV"
     atgtctgaga attatgactc gtcgagtata aaagtactta aaggattaga cgcagtaaga        60
     aagcgtcctg gaatgtatat aggggacacc gatgatggca cgggcttaca ccatatggtg       120
     tttgaggtcg tcgataactc tatagatgaa gccttagcag gtcattgtga tgatattttt       180
     gtaacgattc acttagatgg ttcggtatct gtacgagata acggccgtgg tatcccaact       240
     tcaattcatg aagaagaagg tgtatctgca gccgaagtaa tcatgacggt actgcatgcc       300
     ggtggtaagt ttgatgataa ctcttataaa gtttcaggtg gcttacacgg tgttggtgta       360
     tcggttgtta acgcattatc agaaaagctt aaattaacaa ttcgccgtga aggtaaactt       420
     catgagcaaa catactctca tggtgtacca gatgcgccat tagccgtaat tggcgacgca       480
     gacacaactg gtacagagtt acgtttttgg ccaagtgatc aaacatttac taacttagat       540
     tttcattacg acattttagc taagcgctta cgcgagcttt catttttaaa ctctggcgta       600
     agcattattt taaatgatga gcgtgaagag aataaaagtg atcactttaa atacgaaggc       660
     ggtatcagag cgtttgtaga gtatttaaac cgtaataaaa cacctataca taaaggtgta       720
     ttccacttta cacatacgcg tgaagaagat ggtattgttg ttgaagtgtc aatgcagtgg       780
     aatgatgctt atcaagaaaa catatactgt tttacaaata acatcccaca acgtgatggt       840
     ggtactcact tagccggttt tagatctgcg ctaacacgta cacttaacaa ctatatggaa       900
     aaagaaggct ttaacaaaaa agctaaaaca accagtaatg caacgggtga tgacgctcgt       960
     gaaggcttaa ctgctgttgt aagtgttaaa gtaccagatc ctaagttttc atcacaaact      1020
     aaagacaagc tagtttcgag cgaagttaag tctgcggttg aacaagcaat ggctgaaaaa      1080
     ttcactgagt ttttattaga acacccaaca gatgccaaaa ttgttgtagg taagataata      1140
     gatgcgtcac gtgcgcgtga agctgcacgt aaagcacgtg aaatgacacg tcgtaaaggt      1200
     gcaatggact tagccggttt acctggtaag ttagccgatt gccaagaaaa agatccagca      1260
     caatcagaac tatacatagt ggaaggagac tctgctggcg gatcagccaa gcagggacgt      1320
     aaccgtaaaa accaagctat tcttccgctt aaaggtaaaa tattaaacgt agaaaaagca      1380
     cgttttgata aaatgctttc atcacaagaa gtagcaacac tcattacggc attaggttgt      1440
     ggtattggtc gtgatgaata taatcctgaa aaactgcgct atcaccgtat cattatcatg      1500
     acggatgctg acgtggatgg ttcgcacatt cgtaccttat tacttacgtt cttttatcgc      1560
     caaatgcctg aaattgttga gcgcggatat atttatattg cacaaccacc actttataaa      1620
     gtgaaaaaag gtaagcaaga gcgttatatt aaagatgatc cagcactagt tgaataccta      1680
     acaacacttg ctttaaataa tgcaactttg tacaccagta cagatgcaag cggtattgaa      1740
     ggcgaagcac tagaaaaaat tgttcacgat tatcaaaata ccgttaaggt aattgagcgt      1800
     ctaaaacgta agtttcctaa tactgtaatg aaccgtctta tttaccaaag tgaactgaaa      1860
     aaagaagatc tttcagatga agctaaagta atagcatgga ctaaagaatt agttgatgac      1920
     ttaattgatc gtgatgaaga tgctactatt ttccaagctg caacagagca cgatactgag      1980
     cgcaatttat actacccagt agtgaaaatt cgtcagcacg gtgtagataa agcgcacgta      2040
     cttcattatg attttatagc ttcacgcgat tatcagcgca ttgctgttac tggtgtaaac      2100
     attgcaaata tcattactga aggcgcttat attcaacgcg gtgagaaaac acaacctgtt      2160
     gataactttg tggatgcttt agaatggcta attgctgaat ctaagcgtgg cctctatata      2220
     cagcgctata aagggttggg cgaaatgaac ccaagtcagc tgtgggaaac tacaatggat      2280
     cccgatgcac gtcgtatgct acaagtaacc gttgaagatg cagtagctgc cgatcagtta      2340
     tttgcaacgc taatgggtga ccaagtagaa cctcgtcgcg agtttataga acagaacgcg      2400
     ctacgcgtag ttaacctaga cgtataa                                          2427
//

If you have problems or comments...

PBIL Back to PBIL home page