(data stored in ACNUC7421 zone)

EMBL: CR954246.HEMC

CR954246.HEMC        Location/Qualifiers
FT   CDS_pept        99281..100219
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hemC"
FT                   /locus_tag="PSHAa0098"
FT                   /product="hydroxymethylbilane synthase (porphobilinogen
FT                   deaminase)"
FT                   /function="2.5.12 : Heme, porphyrin, and cobalamin"
FT                   /EC_number="2.5.1.61"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 8117733, 8874804; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0098"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85207"
FT                   /db_xref="GOA:Q3IF72"
FT                   /db_xref="InterPro:IPR000860"
FT                   /db_xref="InterPro:IPR022417"
FT                   /db_xref="InterPro:IPR022418"
FT                   /db_xref="InterPro:IPR022419"
FT                   /db_xref="InterPro:IPR036803"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IF72"
FT                   /protein_id="CAI85207.1"
FT                   /translation="MTQTTNIVRIATRKSALALWQAEFVKAQLEHYHPGILVELVPMST
FT                   QGDIILDTPLAKIGGKGLFVKELEQAMLEGLADMAVHSMKDMPVEFPEGLTLHTICERE
FT                   DPRDAFVSNNFANIDELPQGAIVGTSSLRRQCQIRASRPDLKIHDLRGNVNTRLAKLDS
FT                   GQYDAIILAAAGLIRLEMKDRIRAYIEPEVSLPANGQGAVGIECRTDDEAIKALLAPLE
FT                   HSETRIRVNAERAMNRHLEGGCQVPIGAYALVNGDQVHLRGLVGAIDGSEILRDEVSGH
FT                   VNDAEKLGVELAKMLLAQGADRILAEVYRDA"
     atgacccaaa caacaaatat agtgcgtatt gctactcgta aaagtgcatt ggcactttgg        60
     caagctgaat ttgtaaaggc gcaattagag cattatcacc caggtatttt agtagaatta       120
     gtgcctatgt cgacccaagg cgatattatt ttagataccc ctttagctaa aattggtggt       180
     aaaggtttat ttgttaaaga gcttgaacaa gccatgctag aagggttggc cgatatggcc       240
     gtgcactcga tgaaagatat gcctgtagag tttccagaag ggttaacact acacactatt       300
     tgtgagcgcg aagatccacg tgatgctttt gtatcaaata actttgccaa tattgacgag       360
     ctgccacaag gtgcaattgt gggcacttca agcttacgtc gtcagtgtca aatacgcgca       420
     tcacgtccag atctaaaaat tcatgacctt cgcggtaacg taaatacacg cttagcaaaa       480
     ttagattcag gccaatacga cgcaattatt ttagcagcag caggcttgat ccgtttagaa       540
     atgaaagacc gcattcgtgc ttatattgag ccagaagtgt cattgcctgc caatggacaa       600
     ggtgctgtag gtattgagtg tcgtactgat gacgaagcaa taaaagcatt acttgctcca       660
     ctggagcaca gcgaaacacg tattcgggta aatgccgagc gcgcaatgaa ccgccattta       720
     gaaggtgggt gtcaggtgcc aattggtgct tatgcgctag ttaacggcga tcaagtgcac       780
     ttacgtggtt tagtaggcgc aatagatggt agcgaaattt tacgtgatga agttagcggc       840
     cacgttaatg acgcagaaaa actaggggtt gagctggcta aaatgttatt ggctcaaggt       900
     gcagacagaa tattagctga agtatataga gacgcgtaa                              939
//

If you have problems or comments...

PBIL Back to PBIL home page