(data stored in ACNUC7421 zone)

EMBL: CR954246.HEMF

CR954246.HEMF        Location/Qualifiers
FT   CDS_pept        31394..32368
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hemF"
FT                   /locus_tag="PSHAa0029"
FT                   /product="coproporphyrinogen III oxidase"
FT                   /function="2.5.12 : Heme, porphyrin, and cobalamin"
FT                   /EC_number="1.3.3.3"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 8349542, 10485293, 12975365; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0029"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85143"
FT                   /db_xref="GOA:Q3IDI8"
FT                   /db_xref="InterPro:IPR001260"
FT                   /db_xref="InterPro:IPR018375"
FT                   /db_xref="InterPro:IPR036406"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IDI8"
FT                   /protein_id="CAI85143.1"
FT                   /translation="MAKYLEVNMQSKLLEQVKAYFMALQDTISQGLEAADGKAKFIEDN
FT                   WQRSEGGGGRTRVITNGNIIEQGGVNYSHVFGASMPASATAHRPELAGRSFHACGVSLV
FT                   IHPKNPHIPTSHANVRFFIAEKEGEQPIWWFGGGFDLTPFYPVLDDVVHWHQVAHDLCA
FT                   PFGDELYPKYKTWCDEYFYLKHRDETRGVGGLFFDDLNELGFEQSFAFTQAVGNGFLEA
FT                   YLPIIERRKKDEYTAQQRDFQLYRRGRYVEFNLVWDRGTLFGLQTGGRTESILMSMPPL
FT                   ARWEYNYTPNAESAEAKLYQYYLRPQQWLSTQPNDLIARECQL"
     atggcaaagt atttagaggt taatatgcaa agtaaattat tagagcaagt aaaagcctac        60
     tttatggctt tgcaagacac tattagccaa ggccttgaag cagccgatgg taaagctaag       120
     tttatagaag ataactggca gcgtagcgaa ggcggcggcg gacgtacacg cgttatcact       180
     aatggtaata ttattgagca aggcggtgtt aactactcgc atgtatttgg tgcctctatg       240
     cccgcatctg caaccgcaca cagacccgaa cttgcagggc gaagctttca tgcttgcggt       300
     gtgtcattgg ttattcatcc aaaaaatcca catataccaa ccagtcatgc caatgtgcgt       360
     ttttttattg ccgaaaaaga gggcgaacaa ccaatatggt ggtttggtgg tggctttgac       420
     ttaacccctt tttatcctgt acttgatgat gtagtacatt ggcatcaagt agcacatgac       480
     ttatgtgcac catttggcga tgagttgtat ccaaagtaca aaacctggtg cgatgaatat       540
     ttttatttaa agcatcgcga tgaaacacgc ggtgtaggtg ggttattttt tgacgaccta       600
     aatgaactgg gttttgagca aagctttgcc tttacgcaag cagtaggtaa tggcttttta       660
     gaggcttatt tacctattat agagcgtcgt aaaaaagatg aatacacagc gcagcaacgc       720
     gacttccagc tttatcgtcg tggccgctac gtagagttta atttagtctg ggatagaggc       780
     actctgtttg gtttgcaaac gggtggtcgc accgaatcta tattaatgtc tatgccaccg       840
     ttagcgcgtt gggagtataa ctacactccc aacgcagaga gtgctgaggc taagttatac       900
     cagtattact tacgccctca gcaatggttg agtacacaac caaatgattt aattgctaga       960
     gagtgccagc tttaa                                                        975
//

If you have problems or comments...

PBIL Back to PBIL home page