(data stored in ACNUC7421 zone)

EMBL: CR954246.HEMY

CR954246.HEMY        Location/Qualifiers
FT   CDS_pept        102066..103172
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hemY"
FT                   /locus_tag="PSHAa0100"
FT                   /product="putative HemY (Uncharacterized enzyme of heme
FT                   biosynthesis); by synteny may be involved in heme
FT                   biosynthesis or transport"
FT                   /function="5.2 : From other organisms"
FT                   /function="2.5.12 : Heme, porphyrin, and cobalamin"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homolgy; PubMedId : 12864856"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0100"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85209"
FT                   /db_xref="GOA:Q3IF70"
FT                   /db_xref="InterPro:IPR010817"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IF70"
FT                   /protein_id="CAI85209.1"
FT                   /translation="MIGLIILIIALVVVLAAAPFLLDEKGYVLISFNNTTIEGTIVSFA
FT                   VLTIAVLVVSYLTYKLVRYLFSIYRNTKHSFFARSQGRKQAAIEQALWSVINDDYAQIE
FT                   QALSSKVPDQYQDIRLALLAKAALANNQTDKALEYLFDINPEQQLKVAKLWLASGNSSA
FT                   IESQLRVIAESKKATALELKIYTEVLVQQQHFSALEAFLPRLLRKKVLTNEQWHRVFNA
FT                   YFASFPVDEVTAKYKQLPKKLHSYAYSAYLTQMAAAGQLSVIENDLIKMVKHEEQHAQL
FT                   ANILSKATTANARKLQTSIQDRLKKDEQNNSLLLALACLANAQGDYDLAARVFDKALNN
FT                   ENKKQYMQQAKLSYEKSAQLDKALVLYK"
     atgatagggt tgatcatttt aattattgca cttgttgtgg tgttagcagc agcccctttt        60
     ttattggacg aaaaaggcta tgtactaatt tcgtttaaca acaccacaat tgaaggcaca       120
     attgtttcgt ttgccgtgct aacaatcgca gtattagtcg ttagttattt aacctataaa       180
     ctcgtgcgtt atttattctc tatttatcgc aatactaagc atagtttttt tgctcgtagc       240
     caagggcgca agcaagctgc aattgagcag gcgctatgga gtgtaattaa tgacgactat       300
     gcacaaatag agcaggcgct atctagcaag gtacctgatc agtatcaaga tatacgttta       360
     gcactgcttg ctaaggcggc actagctaat aatcaaaccg acaaagccct tgagtactta       420
     tttgatataa acccagagca gcaactaaaa gtagcaaaac tatggctagc tagtggtaat       480
     agtagcgcta tagagtcgca actacgggtt attgcagaat cgaaaaaagc gacagcactt       540
     gagctaaaaa tttacaccga agtgctagtg cagcaacaac attttagtgc tttagaagca       600
     tttttaccgc gtcttttacg caaaaaagta ctaacaaatg agcagtggca tcgcgttttt       660
     aatgcctatt ttgcctcatt tcctgttgat gaagtaacag ctaaatataa gcagttacct       720
     aaaaagctac atagctacgc ctacagcgct tatttaacgc aaatggctgc tgcagggcag       780
     ttaagcgtaa ttgaaaatga cttaataaaa atggttaagc atgaagaaca acatgcacaa       840
     ttagctaaca tattaagtaa agcaacaacg gcaaatgccc gtaaattaca aacgagtatt       900
     caagatcgac ttaaaaaaga tgagcaaaat aactcattac tgctcgcttt ggcttgtctt       960
     gctaatgcgc aaggtgatta cgacctagcg gcaagggtgt ttgataaagc actaaataat      1020
     gaaaataaaa aacaatatat gcagcaagca aagttaagtt atgaaaaaag tgcacaacta      1080
     gataaagcat tggtacttta taaataa                                          1107
//

If you have problems or comments...

PBIL Back to PBIL home page