(data stored in ACNUC7421 zone)

EMBL: CR954246.HFLC

CR954246.HFLC        Location/Qualifiers
FT   CDS_pept        287934..288812
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hflC"
FT                   /locus_tag="PSHAa0274"
FT                   /product="HflC; HflKC is a membrane-associated complex"
FT                   /function="4.4 : Phage-related functions"
FT                   /function="4.1 : Adaptation to atypical conditions"
FT                   /function="1.6.1 : Protein and peptide secretion and
FT                   trafficking"
FT                   /function="2.2.3.1 : Degradation of proteins, peptides, and
FT                   glycopeptides"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 8947034, 9159109, 9636708, 9792691; Product type r :
FT                   regulator"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0274"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85373"
FT                   /db_xref="GOA:Q3IEZ4"
FT                   /db_xref="InterPro:IPR001107"
FT                   /db_xref="InterPro:IPR010200"
FT                   /db_xref="InterPro:IPR036013"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IEZ4"
FT                   /protein_id="CAI85373.1"
FT                   /translation="MKNFSLVILLAAIVMSFSSVFVVPEGQKAIVLLFSKVQKDSDDQA
FT                   IVYSPGLQFKVPFFSQVRRIDARIQTLDGTPDRFVTSEKKDLIVDSFVKWRVNDFSAFY
FT                   LRARGDKQYAETLLEQKVNNGLRTNFGTRTIREIVSGERSELMEEALVQASESARELGI
FT                   EVLDVRVKQINLPQEVSSSIYQRMRAERTAVAKEHRSEGQEKAETIRAGVDRRVTVMLA
FT                   DAERNSRTVRGQGDADAAAIYANAYNKDPEFFSFVRSLEAYKQTFKNKQDVMVLSPDSD
FT                   FFKYMKGATAQ"
     atgaaaaact ttagtttagt catactatta gctgccattg taatgtcttt ctcgtcagtt        60
     tttgttgtac ctgaagggca aaaagcaatt gttttgttat tcagtaaagt acaaaaagac       120
     agtgatgatc aagccatagt gtacagccca ggcttacaat ttaaagtacc attttttagc       180
     caagtacgtc gtattgatgc acgtattcaa acgcttgatg gtacaccaga ccgctttgta       240
     acgagcgaga aaaaagactt aattgttgac tcgtttgtaa aatggcgtgt taacgacttt       300
     agtgcttttt acttgcgtgc tcgtggcgat aagcaatatg ctgaaacgct gctagaacaa       360
     aaagtaaata acggtctacg tactaacttt ggtacgcgta ctattcgtga aatagtgtcg       420
     ggtgagcgta gcgagttaat ggaagaggcg ttagtacaag cttctgaaag tgcccgcgag       480
     ctaggtattg aagtacttga cgtgcgtgtt aagcaaataa acttaccaca agaagtcagc       540
     agctcgattt atcaacgtat gcgtgctgag cgtactgcgg ttgctaaaga gcatcgttca       600
     gagggtcaag aaaaagccga aacaattcgt gctggcgttg atcgtcgtgt aacggtaatg       660
     cttgccgatg ctgagcgtaa ttcacgtaca gtacgtggtc aaggtgatgc agatgcagca       720
     gctatttatg ctaatgcgta caataaagat cctgagtttt ttagttttgt tcgttcgtta       780
     gaggcgtata aacaaacctt taaaaacaag caagacgtaa tggttctttc accagatagc       840
     gacttcttta aatatatgaa aggtgctact gcacaataa                              879
//

If you have problems or comments...

PBIL Back to PBIL home page