(data stored in ACNUC7421 zone)

EMBL: CR954246.HFLK

CR954246.HFLK        Location/Qualifiers
FT   CDS_pept        286759..287928
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hflK"
FT                   /locus_tag="PSHAa0273"
FT                   /product="HflK complex with HflC"
FT                   /function="1.6.1 : Protein and peptide secretion and
FT                   trafficking"
FT                   /function="2.2.3.1 : Degradation of proteins, peptides, and
FT                   glycopeptides"
FT                   /function="1.7 : Cell division"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 8947034, 9159109, 9636708, 9792691; Product type r :
FT                   regulator"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0273"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85372"
FT                   /db_xref="GOA:Q3IEZ5"
FT                   /db_xref="InterPro:IPR001107"
FT                   /db_xref="InterPro:IPR001972"
FT                   /db_xref="InterPro:IPR010201"
FT                   /db_xref="InterPro:IPR020980"
FT                   /db_xref="InterPro:IPR036013"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IEZ5"
FT                   /protein_id="CAI85372.1"
FT                   /translation="MAWNEPGNNGNDKDPWNNKGGRDQGPPDLDEVLRKFSNKFSGLFG
FT                   GKKPGNGSGGGLGGAGISFILIIAVIVWALSGIYTVKEAERGVVLQFGKYDRIADPGLR
FT                   WKMTFIETIIPVDIEAVRSLSTSGFMLTEDENVVSVEFQVQYRVIDPYLYKFSVTNADS
FT                   SLEEALESALRYVVGHAKMDQVLTNGREVVRQNTWDELNKVIEPYNLGLIVTDVNFKDS
FT                   RPPAEVKDAFDDAIAAQEDEERFIREAEAYAREIEPRARGQVTRMTQEAEGYQERITLE
FT                   AQGEVARFEKLLPEYQAAKTVTRERLYIDAMQEVLGNSSKVLVDVKGGNNMMYLPLDKI
FT                   MEKQGTATRVALPSSSDIQDLRNKVNTSRNSSVNSGSDRFNNDRFNDGR"
     atggcctgga atgaaccggg taataatggc aatgataaag atccgtggaa taacaaaggc        60
     ggacgagatc aaggcccacc tgatttagac gaggtgctgc gtaaattcag taacaagttt       120
     agtggcttat ttggcggcaa aaaaccgggc aatggtagcg gcggtggact tggtggagcc       180
     ggtatttcat ttatacttat aattgctgta attgtatggg cactcagtgg tatttatacc       240
     gtgaaagaag ctgagcgtgg tgtggttctt caatttggta agtatgatcg tattgctgat       300
     cctggtctgc gttggaaaat gacctttatt gaaaccataa taccagtaga tattgaagct       360
     gttcgttcat tatcaacgtc tggttttatg ttaactgaag acgaaaacgt agtaagcgtt       420
     gagttccaag ttcaatatcg tgttattgac ccatacttgt ataaatttag tgtaactaat       480
     gctgatagta gcttagaaga agcactagaa agtgcactac gttatgtagt tggccatgca       540
     aaaatggacc aagtactgac aaacggccgt gaggttgtgc gccaaaatac atgggatgag       600
     ctgaacaagg ttattgaacc ttataactta ggtttaattg tgactgacgt gaactttaaa       660
     gattctcgtc caccggctga agttaaagat gcgtttgatg atgcaattgc tgcacaagaa       720
     gatgaagagc gctttatccg tgaagctgaa gcatatgcgc gtgaaattga acctcgtgct       780
     cgtggtcaag ttacacgtat gactcaagaa gccgaaggtt atcaagagcg tattacactt       840
     gaggcacaag gtgaagttgc tcgttttgaa aagctattac cagaatatca agcggctaaa       900
     acagtaactc gtgaacgttt atacattgat gcaatgcaag aagtattagg caatagctct       960
     aaagtacttg ttgatgtaaa aggtggcaac aacatgatgt acttaccact tgataaaatt      1020
     atggaaaagc aaggcacagc aacccgtgtt gcacttccta gctcaagtga tattcaagat      1080
     ttacgtaaca aagtaaatac gtcacgcaat agctctgtta atagtggtag tgaccgcttt      1140
     aacaacgatc gttttaatga tgggagataa                                       1170
//

If you have problems or comments...

PBIL Back to PBIL home page