(data stored in ACNUC7421 zone)

EMBL: CR954246.HFLX

CR954246.HFLX        Location/Qualifiers
FT   CDS_pept        285368..286657
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hflX"
FT                   /locus_tag="PSHAa0272"
FT                   /product="HflX, putative GTPase subunit of protease with
FT                   nucleoside triP hydrolase domain"
FT                   /function="1.6.1 : Protein and peptide secretion and
FT                   trafficking"
FT                   /function="2.2.3.1 : Degradation of proteins, peptides, and
FT                   glycopeptides"
FT                   /function="4.4 : Phage-related functions"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 8248183, 7748952; Product type r : regulator"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0272"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85371"
FT                   /db_xref="GOA:Q3IEY9"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR016496"
FT                   /db_xref="InterPro:IPR025121"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030394"
FT                   /db_xref="InterPro:IPR032305"
FT                   /db_xref="InterPro:IPR035647"
FT                   /db_xref="InterPro:IPR042108"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IEY9"
FT                   /protein_id="CAI85371.1"
FT                   /translation="MFDRYKSGEQAVLVHIDFPKEGDREDLHELELLVSSAGVSSLAVV
FT                   QGSRQAPHPKLFVGTGKAEEIAETVKIHNADVVIFNHQLRPSQERNLERILQCRVLDRT
FT                   TLILDIFAQRARTHEGKLQVELAQLRHMSTRLIRGWTHLERQKGGVGLRGPGETQLETD
FT                   RRLLRARLQNIRARLDKVAVQREQGRRARSRNEIPTVSLVGYTNAGKSTLFNRITNSDV
FT                   YAADQLFATLDPTLRKLELGDVGPVILADTVGFIRHLPHDLVAAFKATLTETREADLQL
FT                   HVIDVADARLKENIEQVQSVLKEIEADEVPQLLVYNKIDALDDITARIDRDDEGQPIRV
FT                   WLSAQTGEGCELLSEAISELLAKQMLSETLLLAPQYGRLRSSLFSLSAVSDERFDEQGN
FT                   WLLDVRLPVVEWNRLIKEFGPEIAGFIVCD"
     ttgtttgacc gctataaatc tggcgaacag gcagttttag ttcatattga ctttcctaaa        60
     gagggggatc gtgaagatct tcacgaatta gaattgttgg tatcttctgc tggtgttagt       120
     agtttggcgg ttgtgcaagg cagccgtcaa gcaccacatc cgaaactatt tgtcggaact       180
     ggtaaagcag aagaaatagc tgagactgtt aaaatccaca atgccgatgt cgttattttt       240
     aatcatcaac tcagaccgtc ccaagagcgt aacttagaac gcattttgca atgtcgtgtg       300
     cttgatagaa ccacccttat tcttgatata tttgcgcaac gtgcacgtac ccacgaaggt       360
     aagttgcaag ttgaactggc gcaattgcgt catatgtcca cgcgactaat tcgtggttgg       420
     acgcatttag agcgtcaaaa agggggcgtg ggtttgcgtg ggccaggtga aacacagctc       480
     gaaaccgata gacgcttatt gcgcgcccgc ctgcaaaata ttcgtgcacg cctagataaa       540
     gttgctgtac agcgcgagca aggtagacga gctcgtagcc gtaacgaaat accaactgta       600
     tcgttagtag ggtatactaa cgcgggtaaa tcaacattat ttaatcgtat tacaaactca       660
     gatgtttatg ctgcagatca attgtttgcg acgcttgacc caacgttacg aaaacttgag       720
     ttaggcgatg ttggtccggt tattttagcc gatactgttg gctttattcg ccatttgccg       780
     catgacttag tggcggcatt taaagcgacg ctaacagaaa cgcgagaagc cgacttacag       840
     ctgcatgtta ttgatgtggc agatgcacga ctaaaagaaa atattgaaca agtacaatca       900
     gtactcaaag aaattgaagc tgatgaagta ccgcaattat tggtttataa caaaattgat       960
     gcgctggatg atattactgc gcgtattgat cgcgatgatg aaggccaacc tataagggta      1020
     tggctttctg ctcaaaccgg cgaaggttgc gagttactta gcgaagctat tagcgaatta      1080
     cttgctaaac aaatgcttag cgaaacatta ttgctcgcac cacaatatgg acggttaaga      1140
     tcgtcgttat ttagtttaag tgcggtaagc gacgagcgct ttgatgaaca aggtaactgg      1200
     ctgttagatg ttaggttacc tgtagttgag tggaatcgtt taattaaaga atttggtcct      1260
     gaaattgctg gttttatcgt ctgtgattaa                                       1290
//

If you have problems or comments...

PBIL Back to PBIL home page