(data stored in ACNUC7421 zone)

EMBL: CR954246.HFQ

CR954246.HFQ         Location/Qualifiers
FT   CDS_pept        285088..285351
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hfq"
FT                   /locus_tag="PSHAa0271"
FT                   /product="Host factor-I; polyA binding protein"
FT                   /function="3.2.2 : Processing and degradation of RNA"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 12634847, 12834354, 12853626, 14561880, 7748952; Product
FT                   type mc : molecular chaperone"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0271"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85370"
FT                   /db_xref="GOA:Q3IDT7"
FT                   /db_xref="InterPro:IPR005001"
FT                   /db_xref="InterPro:IPR010920"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3IDT7"
FT                   /protein_id="CAI85370.1"
FT                   /translation="MAKGQSLQDPFLNALRRERIPVSIFLVNGIKLQGKIQSFDQFVIL
FT                   LENTVNQMVYKHAISTVVPARAVNFQGVQENDDTEEPEAGNI"
     atggcaaaag gccaatcgtt acaagaccca tttttgaatg cactacgccg tgagcgcatc        60
     ccagtatcaa tctttttggt taatggcata aaattacaag gtaaaattca gtcatttgat       120
     caatttgtta ttttattaga aaacaccgta aatcaaatgg tgtataaaca tgcaatttca       180
     acagttgttc ctgctcgtgc agttaatttc caaggtgttc aagaaaatga cgacactgaa       240
     gaacctgaag ctggaaacat ttaa                                              264
//

If you have problems or comments...

PBIL Back to PBIL home page