(data stored in ACNUC7421 zone)

EMBL: CR954246.HSLO

CR954246.HSLO        Location/Qualifiers
FT   CDS_pept        complement(243346..244191)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hslO"
FT                   /locus_tag="PSHAa0229"
FT                   /product="heat shock protein 33, redox regulated chaperone"
FT                   /function="4.1 : Adaptation to atypical conditions"
FT                   /function="3.3.7 : Protein folding"
FT                   /note="Evidence 2b : Function of strongly homologous gene;
FT                   PubMedId : 10025400; Product type f : factor"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0229"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85332"
FT                   /db_xref="GOA:Q3ILP2"
FT                   /db_xref="InterPro:IPR000397"
FT                   /db_xref="InterPro:IPR016153"
FT                   /db_xref="InterPro:IPR016154"
FT                   /db_xref="InterPro:IPR023212"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3ILP2"
FT                   /protein_id="CAI85332.1"
FT                   /translation="MQQDLLHRYLFDNLDVRGELVQIENAYNEMIANHNYPDAVKALLG
FT                   ELLVATCLLTATLKFEGEIAVQLQGDGPVKYAVINGDDKQNMRGIARLQSEVTGSTVKE
FT                   LIGQGYMVITITPTKGERYQGIVPLEHETLSECIEAYFEQSEQLKTRLWFATDTTEGNA
FT                   KACGLFLQVLPVDKQKSIEDFAHLEALSHTIKDEELLELDANTVLTRLYHEDNPRVFEP
FT                   QSIQFKCGCTREKTMTALVNIGQQALLDDVAEHGEIKISCHYCLKDYLFDEQDVKNIFN
FT                   "
     atgcaacaag atttactcca ccgttattta ttcgacaatc tcgatgttcg tggcgaactc        60
     gtacaaattg aaaatgccta caacgaaatg atcgccaatc ataattaccc tgatgcagtt       120
     aaagcattat tgggtgaact gcttgttgcg acctgtttat taacagccac cttaaaattt       180
     gaaggcgaaa tagcggttca actacaaggt gatggtccgg ttaaatacgc ggtaattaat       240
     ggcgacgata aacaaaacat gcgtggtata gctcgcttac aaagtgaagt aacaggtagc       300
     acagtaaaag agttgatagg ccaaggctat atggttatta ctattacgcc aactaaaggg       360
     gagcgctatc aaggtatagt gcctttagag catgaaacct taagtgaatg tatagaggct       420
     tactttgagc aatcagagca attaaaaacg cgtctttggt ttgcaaccga tacaaccgag       480
     ggaaatgcca aagcttgtgg tttattttta caagttttac ccgttgataa acaaaaatct       540
     attgaagact ttgcccactt agaagctctt agccatacca ttaaagatga agaactatta       600
     gagcttgatg ctaacaccgt actaactcgt ttgtaccacg aagataaccc gcgtgtgttt       660
     gagccacaaa gcattcaatt taagtgtggt tgtacccgcg aaaaaaccat gactgcatta       720
     gttaatattg gccaacaagc gctacttgat gatgttgctg agcatggcga aatcaaaatt       780
     agctgccatt actgtctaaa agattatctt tttgatgagc aagatgtgaa aaacattttt       840
     aactaa                                                                  846
//

If you have problems or comments...

PBIL Back to PBIL home page