(data stored in ACNUC7421 zone)

EMBL: CR954246.HSLR

CR954246.HSLR        Location/Qualifiers
FT   CDS_pept        complement(244204..244626)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hslR"
FT                   /locus_tag="PSHAa0230"
FT                   /product="heat shock protein 15, DNA/RNA-binding"
FT                   /function="4.1 : Adaptation to atypical conditions"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 10675343, 9867837; Product type f : factor"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0230"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85333"
FT                   /db_xref="GOA:Q3ILP1"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR025708"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="UniProtKB/TrEMBL:Q3ILP1"
FT                   /protein_id="CAI85333.1"
FT                   /translation="MAKKSNANPNLEHKDELKIRLDKWLWAARFYKTRAAAREMVQGGK
FT                   VHYNGQRTKAGKIVEIGATIKLAQGVDEKIVTVLKILEKRQSAPIAQTLYQESDASIAK
FT                   REENSIARKNNSLFAPHPDKKPDKKQRRELLKLKLS"
     atggctaaaa aaagtaatgc taaccctaat ttagaacata aagatgagct aaaaattaga        60
     ttagacaaat ggttatgggc ggcacgattt tataaaacac gtgctgcggc tcgcgaaatg       120
     gtacaaggcg gaaaagtaca ttataatggc cagcgtacca aagcaggcaa aatagtagaa       180
     ataggcgcaa ctataaaatt agcccaaggg gtagatgaaa aaatagtaac tgtgctcaaa       240
     atacttgaaa aacgccaaag cgcccccatt gcacagacct tgtatcaaga atctgatgcc       300
     agtattgcta aacgcgaaga aaattctatc gcgcgcaaaa ataacagcct ttttgcacct       360
     catccggata aaaaaccgga taagaagcaa agacgcgaac ttttaaaatt gaaattaagt       420
     tag                                                                     423
//

If you have problems or comments...

PBIL Back to PBIL home page