(data stored in ACNUC7421 zone)

EMBL: CR954246.KAMA

CR954246.KAMA        Location/Qualifiers
FT   CDS_pept        complement(490999..491925)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="kamA"
FT                   /locus_tag="PSHAa0473"
FT                   /product="putative lysine 2,3 aminomutase"
FT                   /function="2.2.3.2 : Degradation of aminoacids"
FT                   /function="2.8 : Metabolism of sulfur"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homolgy; PubMedId : 11222759, 11578923, 10839984, 14532061;
FT                   Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0473"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85570"
FT                   /db_xref="GOA:Q3IFP6"
FT                   /db_xref="InterPro:IPR003739"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR022462"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IFP6"
FT                   /protein_id="CAI85570.1"
FT                   /translation="MVGLSSQVHDNDIKARSLFPVRVPIPFIKKMRKGDANDPLLLQVM
FT                   PRHQEFLTKSGFNKDPLLEQSNQQPGLLHKYKSRVLVMFKTGCAVNCRYCFRRHFPYQE
FT                   NQLNKRSLLDALSYIKSDNNINEVILSGGDPLMAKDDAISWFLDELEQLPQIKRMRIHT
FT                   RLPVVIPARITDELCERLARSPLKIVFVNHINHANEIDDDFKAAMQKLKQVGVVLFNQA
FT                   VILKDVNDTTAAQVNLSEALFDADVLPYYLHLLDKVEGASHFDISEEQAIKIMAELLEA
FT                   LPGFLVPKLVREIGGEKSKTPIDLKLI"
     atggtcggtt tatcgagcca agtccatgat aacgacataa aagctcgtag cttgttccca        60
     gttcgtgtgc caataccatt tataaaaaaa atgcgtaaag gcgatgcaaa cgatccatta       120
     ttattacaag ttatgccgcg ccatcaagaa ttcttaacta aaagtggttt taataaagat       180
     cccctgcttg agcaaagtaa ccagcagcca gggctattac acaagtataa atcgcgtgtt       240
     ttagtaatgt ttaaaaccgg ttgtgcagta aattgccgct attgttttag acgccatttt       300
     ccgtatcaag aaaaccaact taataagcgt agcctgctag atgcgcttag ctatataaaa       360
     tccgacaata atataaatga agtgatttta agtggtggcg atccgctcat ggccaaagac       420
     gatgccatta gttggttttt agatgagctt gagcaactac cacaaattaa acgcatgcga       480
     attcataccc gtctgccggt ggttattccg gcgcgcatta ccgatgagtt atgcgaaaga       540
     cttgcaaggt cgccattaaa aattgtgttt gttaatcata taaaccatgc caacgaaata       600
     gacgacgact ttaaagccgc aatgcaaaag cttaaacaag taggtgtagt gctatttaat       660
     caagcggtta ttttaaaaga cgtgaacgat acaactgcag cacaagtgaa tttaagtgaa       720
     gcgttatttg atgccgatgt attgccctat tatttacatt tgctagataa ggtagaaggg       780
     gcaagccact ttgacattag tgaggagcaa gcaataaaaa taatggcaga gctgttagaa       840
     gccctacctg gttttttagt gcctaaattg gtcagagaga ttggcggtga aaaaagtaaa       900
     acgccaatcg atcttaagtt aatttaa                                           927
//

If you have problems or comments...

PBIL Back to PBIL home page