(data stored in ACNUC7421 zone)

EMBL: CR954246.LPD

CR954246.LPD         Location/Qualifiers
FT   CDS_pept        409248..410675
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lpd"
FT                   /locus_tag="PSHAa0393"
FT                   /product="dihydrolipoamide dehydrogenase,
FT                   FAD/NAD(P)-binding, component of the 2-oxoglutarate
FT                   dehydrogenase and the pyruvate dehydrogenase complexes"
FT                   /function="2.1 : Metabolism of carbohydrates and related
FT                   molecules"
FT                   /EC_number="1.8.1.4"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 6352260; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0393"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85491"
FT                   /db_xref="GOA:Q3IIH6"
FT                   /db_xref="InterPro:IPR001100"
FT                   /db_xref="InterPro:IPR004099"
FT                   /db_xref="InterPro:IPR006258"
FT                   /db_xref="InterPro:IPR012999"
FT                   /db_xref="InterPro:IPR016156"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IIH6"
FT                   /protein_id="CAI85491.1"
FT                   /translation="MSNELKTQVVVLGGGPGGYSAAFRAADLGLEVTLVESRDTLGGVC
FT                   LNVGCIPSKALLHVAKVIDDAAAMADHGVTFGAPQIDLDKIRSWKDSVIGQLTGGLTSM
FT                   SKMRKVKVVYGYGKFTGSNTIAVEGTDGTTTITFDNAIIAAGSKPVSLPFIPEDDRVID
FT                   STGALELKDIPEKLLVLGGGIIGLEMGTVYRALGSAIDVVEFADQLVPAADKDIVKIYQ
FT                   KYVSDKFNVMLSTKVTGIDAKDDGLYVTFEGKNAPAEPVRYDKVLVAVGRTPNGKLLDA
FT                   DKAGVNVDDRGFINVDKQLKTNVEHIFAVGDIVGQPMLAHKAVHEAHVAAEVISGQKHY
FT                   FDPKCIPSIAYTDPEMAWVGVTEKEAKEQGLSIETAVFPWAASGRAIASARTEGSTKLI
FT                   FDKESGRVIGGAMVGINAGEMLGEIGLAVEMGADGEDLALTIHAHPTLNESIGLAAEIY
FT                   EGSITDLPNKKAVKKKK"
     atgagcaacg aattaaaaac tcaagttgtt gtactaggcg gtggtcctgg tggttactct        60
     gcggctttcc gtgctgctga cttgggctta gaagttacac tagttgagtc tcgcgataca       120
     ctaggcggtg tatgtctaaa tgtgggttgt atcccttcaa aagcgctttt acacgtagct       180
     aaagtaattg atgacgcagc ggcaatggcc gatcatggcg ttacttttgg cgcaccacaa       240
     attgacttag acaaaatccg ttcatggaaa gactctgtta ttggccaact aactggtggc       300
     ttaactagca tgtcgaaaat gcgtaaagtt aaagttgtat acggttacgg taaatttact       360
     ggcagcaaca ccattgctgt tgaaggcacc gacggtacaa caacaattac gttcgacaac       420
     gcaattattg ctgcaggttc taaaccagtt agcttacctt tcatcccaga agatgaccgc       480
     gtaattgact caactggtgc actagagctt aaagatatcc ctgaaaagct acttgtactt       540
     ggcggtggta ttattggcct tgaaatgggc acagtatacc gtgcactagg ttcagcaatc       600
     gacgtagttg aatttgctga tcaactagta cctgctgctg ataaagacat tgttaaaatt       660
     taccaaaagt acgtaagcga caaatttaat gtaatgcttt ctactaaagt aacgggcatt       720
     gacgcaaaag acgatggcct atatgtaacg tttgaaggta aaaacgcacc agcagaacca       780
     gtacgttacg acaaagtact tgtagcagtt ggccgtacac caaacggtaa gttacttgat       840
     gcagataaag caggcgttaa cgttgatgat cgcggcttta ttaatgttga taagcagctt       900
     aaaactaacg ttgagcacat ttttgcagtg ggcgacattg ttggccagcc tatgcttgcg       960
     cataaagcag ttcacgaagc acacgttgca gctgaagtta tttctggtca aaaacattac      1020
     tttgatccta aatgtattcc ttcaattgcc tacacagatc cagaaatggc gtgggttggt      1080
     gtaactgaaa aagaagcaaa agagcaaggc cttagcattg aaactgcggt attcccgtgg      1140
     gctgcatcag gtcgtgcaat tgcatctgca cgtacagaag gctctactaa gcttattttt      1200
     gataaagaaa gtggccgtgt aatcggtggc gctatggttg gtattaacgc aggcgaaatg      1260
     ctgggcgaaa ttggcctagc agtagaaatg ggcgcagatg gcgaagactt agcacttacc      1320
     attcatgctc acccaacatt gaacgaatca atcggcctag cagctgaaat ttacgaaggt      1380
     tcaatcactg acttaccaaa taaaaaagca gttaaaaaga aaaagtaa                   1428
//

If you have problems or comments...

PBIL Back to PBIL home page