(data stored in ACNUC7421 zone)

EMBL: CR954246.LYSA

CR954246.LYSA        Location/Qualifiers
FT   CDS_pept        complement(95744..96997)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lysA"
FT                   /locus_tag="PSHAa0093"
FT                   /product="putative diaminopimelate decarboxylase"
FT                   /function="2.2.1.2 : Aspartate family"
FT                   /EC_number="4.1.1.20"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homolgy; PubMedId : 10625645; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0093"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85202"
FT                   /db_xref="GOA:Q3IEW2"
FT                   /db_xref="InterPro:IPR000183"
FT                   /db_xref="InterPro:IPR002986"
FT                   /db_xref="InterPro:IPR009006"
FT                   /db_xref="InterPro:IPR022643"
FT                   /db_xref="InterPro:IPR022644"
FT                   /db_xref="InterPro:IPR022653"
FT                   /db_xref="InterPro:IPR022657"
FT                   /db_xref="InterPro:IPR029066"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IEW2"
FT                   /protein_id="CAI85202.1"
FT                   /translation="MDFFNYKNNQLFAEDVSIASIAQQYGTPCYVYSRATFERHYLAFA
FT                   NATKNHKSLVCYAVKANSNIAVLNILARLGSGFDIVSKGELARVIKAGGDASKVVFSGV
FT                   AKTADEIAYALKLGIKCFNVESVSELERISEVACELNLAAPISIRVNPDIDAKTHPYIS
FT                   TGLKENKFGIDIQTAVSVYQHAASLPGLNIIGVDCHIGSQLTETRPFLEALDKLLTLID
FT                   ELKACNIELTHLDIGGGLGVTYNDEQPPHPSEYAAQVTERLVNYRHLELIFEPGRAIAA
FT                   NAGVLVTQVEFIKQNQDKYFAIVDAGMNDMLRPALYQAWQKIIPVSVRDDETPTHNFDI
FT                   VGPVCETGDFLGKDRELALKQGDLLVQRSAGAYGFTMSSNYNSRPRVAEIMVDGSQHHL
FT                   IRERETIESLYQGEKILP"
     atggattttt ttaattataa aaacaatcaa ttatttgctg aagacgtaag cattgcaagt        60
     attgctcagc aatatggtac gccatgctac gtttattcgc gagccacctt tgagcgccat       120
     tatttagcct ttgctaatgc tactaaaaat cataaatccc tggtgtgcta cgccgttaaa       180
     gccaactcta atattgcggt actcaatata ttagcgcgtt tagggtcggg cttcgacatt       240
     gtatctaagg gtgaactggc gcgagtaatt aaagccggtg gcgacgcctc caaagtggtg       300
     ttttcgggtg tggctaaaac agcagacgaa atagcctatg cattaaagct cggaattaaa       360
     tgctttaatg ttgagtcggt ctcggagcta gaacgtattt cagaagtggc ctgtgagcta       420
     aatttagcag cgcctatttc tattcgcgtt aaccccgata tagatgcaaa aacgcatccg       480
     tatatttcta ccggcttaaa agaaaacaag tttggtatag atattcaaac agctgtgagc       540
     gtatatcagc atgccgcttc actgcctgga ttaaacatta ttggcgttga ttgccatatt       600
     ggctcacaac tcaccgaaac cagacctttt cttgaagcac ttgataagct actaacgcta       660
     atagatgaat taaaagcgtg taacatcgag cttacccatt tagatatagg cggtggttta       720
     ggggtaactt ataatgacga gcaacctccg caccctagcg aatatgcagc gcaagttact       780
     gagcgcctag ttaattatcg ccaccttgag cttatatttg aacccggtcg cgccattgct       840
     gctaacgcag gagttttagt tactcaagtt gaatttatta aacaaaacca agataagtac       900
     tttgctattg ttgatgcagg catgaacgac atgctgcgcc cagcgcttta tcaagcatgg       960
     caaaaaatca ttccggtatc ggtacgcgac gacgaaaccc ctactcataa ctttgatatt      1020
     gttggccctg tttgcgaaac tggtgacttt ttaggtaaag accgcgagtt agcacttaaa      1080
     caaggcgact tactggtaca aagaagtgcc ggtgcttatg gctttactat gagttcaaat      1140
     tataactctc gtccgcgtgt tgcagaaata atggtagatg gcagtcaaca ccatcttatt      1200
     cgcgaacgcg aaaccataga gagcctgtat caaggtgaga aaattttacc ttaa            1254
//

If you have problems or comments...

PBIL Back to PBIL home page