(data stored in ACNUC7421 zone)

EMBL: CR954246.LYSC

CR954246.LYSC        Location/Qualifiers
FT   CDS_pept        549431..550648
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lysC"
FT                   /locus_tag="PSHAa0533"
FT                   /product="Aspartokinase"
FT                   /function="2.2.1.2 : Aspartate family"
FT                   /EC_number="2.7.2.4"
FT                   /note="Evidence 2b : Function of strongly homologous gene;
FT                   Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0533"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85622"
FT                   /db_xref="GOA:Q3ILF2"
FT                   /db_xref="InterPro:IPR001048"
FT                   /db_xref="InterPro:IPR001341"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR005260"
FT                   /db_xref="InterPro:IPR018042"
FT                   /db_xref="InterPro:IPR027795"
FT                   /db_xref="InterPro:IPR036393"
FT                   /db_xref="InterPro:IPR041740"
FT                   /db_xref="UniProtKB/TrEMBL:Q3ILF2"
FT                   /protein_id="CAI85622.1"
FT                   /translation="MALIVQKFGGTSVGSIERIEAVADLVVKTKQQGHQVVVVLSAMSG
FT                   ETNRLINLAKQIDTRPSSRELDVLISTGEQVSVALLAMAIIKRGHSAVSLLADQVNILT
FT                   DNMFGKARITDVAATRLKHELEHNRIAIIAGFQGRDIEGNVTTLGRGGTDTSAVEIAGA
FT                   IKADECQIYTDVNGVYTTDPRVEPNARRMSQVTFAEMLELASLGAKVLHIRSVEAAGKH
FT                   NVPLRVLSSFYPDAGTLISFEESDMPGNVVSGIAFNRDECLINVEGVLSGTQYLAKILK
FT                   LFADNGIEIDMINQVNHNVDKVDYAFTVHTNDYLHALDVLTEQQAQLTAQNIFGLTTVA
FT                   KVSAVGMGMKSHSGVASLFFDALAAENINVILVSTSEIKISVLIDEKYLELAVRALHKI
FT                   FLTENE"
     gtggcactta ttgttcaaaa gttcggtggc acttcagttg gttcaataga gcgaattgaa        60
     gcggttgccg accttgttgt taaaactaaa caacaaggcc atcaagtggt tgtagtgctc       120
     tcggctatgt cgggagaaac caaccgctta attaatctcg ccaaacaaat agatactcgg       180
     ccaagtagcc gtgaacttga cgtattaatt agcaccggcg agcaggtttc ggtggcttta       240
     ttagctatgg ctattattaa acgcggtcat tctgctgtga gtttattagc cgatcaggtt       300
     aatattttaa ccgataatat gtttggcaaa gcccgtatta cagatgtagc tgcaacgcgt       360
     ttaaaacatg agcttgagca taaccgtatt gcaattattg cgggttttca gggccgtgat       420
     attgaaggaa atgtaactac attagggcgt ggcggtaccg atacttcggc ggttgaaatt       480
     gctggagcaa taaaagctga cgaatgtcag atctataccg acgttaacgg cgtatatact       540
     acagaccctc gtgttgaacc taatgcacga cgaatgagcc aagttacctt tgctgaaatg       600
     ctagagttag caagtttagg ggctaaagta ttgcatattc gttcagttga agcggcagga       660
     aagcacaatg tgccacttag ggtgctatca agtttttacc ctgatgctgg tacattgatt       720
     agttttgagg agagcgatat gcctggtaat gtcgtttcgg gtattgcgtt taatcgtgat       780
     gaatgtttaa taaatgtaga gggtgtactt agtggtacac aatatcttgc aaagattttg       840
     aaactttttg cagataatgg catcgaaata gatatgatta atcaagttaa tcataatgtt       900
     gacaaagtag actatgcttt tactgtacac acaaatgatt atttacacgc attagacgtt       960
     ttaacagagc agcaagctca gttaacagca caaaatattt ttgggttaac aacagtcgct      1020
     aaagtgtctg ctgttggtat gggtatgaag tcacattcgg gtgttgctag tttatttttt      1080
     gatgcattag ctgcagaaaa tattaatgtt attttagtgt ctacatcaga aattaaaata      1140
     tcggttttaa tagatgaaaa atacctagag ttggctgttc gtgcattaca taagatattt      1200
     ttaacagaaa atgaatag                                                    1218
//

If you have problems or comments...

PBIL Back to PBIL home page