(data stored in ACNUC7421 zone)

EMBL: CR954246.LYSS

CR954246.LYSS        Location/Qualifiers
FT   CDS_pept        532684..534219
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lysS"
FT                   /locus_tag="PSHAa0518"
FT                   /product="lysyl-tRNA synthetase"
FT                   /function="3.3.2 : Aminoacyl-tRNA synthetases"
FT                   /EC_number="6.1.1.6"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 7678344, 7961513, 12142429; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0518"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85608"
FT                   /db_xref="GOA:Q3ILD7"
FT                   /db_xref="InterPro:IPR002313"
FT                   /db_xref="InterPro:IPR004364"
FT                   /db_xref="InterPro:IPR004365"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR018149"
FT                   /db_xref="UniProtKB/TrEMBL:Q3ILD7"
FT                   /protein_id="CAI85608.1"
FT                   /translation="MTDQIQDENKLIAERRGKLDAIRQNCPANGHPNQFRREHYTADLQ
FT                   AQFGDKSKEELVELQQVVSIAGRILAKRGPFFVIQDMKGRVQSYASKDVQKDLKEKYGQ
FT                   LDTGDIIGVKGALNKSGKGDLYVEMTEYQLLTKSLRPLPEKFHGLSDQETKYRQRYVDL
FT                   ITNEATRETFRIRSQVVEGIRRFLADRDFMEVETPMLQVIPGGASARPFVTHHNALDID
FT                   MYLRIAPELYLKRLVVGGFDRVFEINRNFRNEGLSTRHNPEFTMIEFYQAYADYIDLMN
FT                   ITEDMLRTVAENVLGSAVVVNTTKDENGEVIDSVEYDFGQPFTRLSMSDAILKYNPEFD
FT                   AAVFNDPENHFEQLKAYAKQVHVKIPENCVWGPGKFLCEIFEETAEHMLIQPTFITGYP
FT                   WEVSPLARRNDENSFVTDRFEFFVGGRELANGFSELNDAQDQAERFTRQVEEKDAGDDE
FT                   AMHYDEDYIRALEYGLPPTAGEGIGIDRLVMLFTDSPTIKDVILFPHMRPQAD"
     atgactgatc aaatccaaga cgaaaacaag ttaatcgctg agcgtcgtgg caaattagat        60
     gctatacgcc aaaattgccc agccaacggt catccaaacc aattccgtcg tgagcattac       120
     acggcagatt tgcaagccca gtttggtgat aagagcaaag aagaattagt agagttacaa       180
     caagtagtgt ctattgctgg acgtatttta gcaaagcgcg gaccattttt tgtaattcaa       240
     gacatgaaag gccgcgtaca atcatatgcg tctaaagatg tgcaaaaaga tttaaaagaa       300
     aaatatggcc aactagatac tggcgatatt attggtgtta aaggcgcgct taataaatcg       360
     ggtaaaggcg atttatacgt agaaatgaca gagtaccaac tattaactaa gtcacttcgc       420
     ccgttgccag aaaaattcca tggcttatca gatcaagaaa ctaagtaccg tcaacgttac       480
     gttgatttaa ttactaacga agcaacgcgt gaaacattcc gcattcgctc acaagtagtt       540
     gaaggcattc gtcgcttttt agcagaccgt gactttatgg aagtagaaac acccatgcta       600
     caggttattc ctggcggtgc atcggcacgc ccgtttgtaa cacaccataa cgcgcttgat       660
     attgacatgt acctacgtat agcgcctgag ctgtacttaa agcgtttagt ggtaggtggt       720
     tttgatcgcg tattcgaaat taaccgtaac ttccgtaacg aagggttatc tacgcgtcac       780
     aatccagaat tcacaatgat tgaattttac caagcatacg ctgattacat cgatctgatg       840
     aacattaccg aagacatgct acgtacagtt gcagaaaacg tacttggtag tgctgtggta       900
     gttaacacaa ctaaagacga aaacggcgaa gtaattgact cagttgaata cgattttggt       960
     caaccgttta cgcgcttaag catgagcgac gcaattttaa aatataaccc tgagtttgat      1020
     gcggcagtat ttaacgaccc agaaaaccat tttgaacaat taaaagcgta cgctaagcaa      1080
     gtacacgtta aaattcctga aaactgtgtt tggggcccag gtaaattttt gtgtgaaata      1140
     tttgaagaaa cagcagagca catgcttatt caacctacgt ttattaccgg ctacccatgg      1200
     gaagtatcac cattggcacg tcgtaacgat gaaaattcat ttgttacaga ccgctttgag      1260
     ttttttgttg gcggacgtga gctggctaat ggtttctctg agcttaacga tgcacaagac      1320
     caagcagagc gttttactcg tcaagttgaa gagaaagacg caggcgatga tgaagcaatg      1380
     cattacgacg aagactacat acgcgcacta gagtatggct taccaccaac tgcaggtgaa      1440
     ggtattggta ttgaccgttt agtaatgctg tttactgact ctccaaccat taaagacgtt      1500
     atcttgttcc cgcatatgcg cccgcaagcc gactaa                                1536
//

If you have problems or comments...

PBIL Back to PBIL home page