(data stored in ACNUC7421 zone)

EMBL: CR954246.MIAA

CR954246.MIAA        Location/Qualifiers
FT   CDS_pept        284086..285006
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="miaA"
FT                   /locus_tag="PSHAa0270"
FT                   /product="delta(2)-isopentenylpyrophosphate tRNA-adenosine
FT                   transferase"
FT                   /function="3.2.3.1 : tRNA modifications"
FT                   /EC_number="2.5.1.8"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 9148919, 10692168, 11160115; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0270"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85369"
FT                   /db_xref="GOA:Q3IDT9"
FT                   /db_xref="InterPro:IPR018022"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR039657"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3IDT9"
FT                   /protein_id="CAI85369.1"
FT                   /translation="MLSNLPVIFLMGPTAAGKTALAISLCEHLNTEIISVDSALVYKGM
FT                   DIGTAKPDASELARAPHHLIDLLDPSETYSVADFRRDAIIKIDEFHQQGKVPVLVGGTM
FT                   LYFKALIDGLSPLPEANVEIRAELEAQAAQYGWPHLYQELVKIDPQAAQKMSENDSQRI
FT                   NRALEVYKLTGKTMTELQKQKQPVLPYTFHQFAIAPTQRSELHQRIEKRFKIMLEQGFE
FT                   NEVSTLYLRKDLHPNMPSIRCVGYRQMWDYLAGEIDHDEMVFRGIAATRQLAKRQLTWL
FT                   RSWPDVTWLTTGDEENLHRVVSSLS"
     gtgttgagta atttaccagt catattttta atgggtccaa ctgcagcggg taaaacggcg        60
     ttggcaattt cattgtgtga gcatttaaat accgaaataa ttagtgttga ttcagcgtta       120
     gtatataagg gtatggatat tggcacggct aaacccgatg catcagagtt agcacgtgct       180
     ccgcatcact taattgattt acttgaccca agtgaaactt attcagttgc tgattttaga       240
     cgtgatgcga taataaaaat agatgaattt catcagcaag gtaaggtgcc ggtattagtt       300
     ggcggcacca tgttgtactt caaggctctg attgatggtt tatcaccact gccagaagct       360
     aacgtggaaa taagagccga acttgaagcg caagctgcgc aatatggctg gccacatttg       420
     tatcaagaac tggtaaaaat agacccgcaa gcagcgcaaa aaatgagtga aaacgattca       480
     caaagaatta atcgtgcttt agaggtatac aaattaacag gtaaaaccat gaccgagctg       540
     caaaagcaaa aacagccggt tttaccttat acttttcatc aatttgctat tgcgccaacg       600
     cagcgcagtg aattacatca gcgaattgaa aaaaggttta aaataatgct cgaacagggg       660
     tttgaaaatg aagtttcgac cctatatcta cgtaaggatt tacaccccaa tatgccttct       720
     attcgttgtg taggttatag acaaatgtgg gattaccttg cgggtgaaat tgaccatgat       780
     gaaatggtat ttcgcggcat tgcggctaca cgtcaattgg ctaaacgcca attaacttgg       840
     ttaagaagct ggcctgatgt tacatggtta acaacgggtg atgaagaaaa cttgcatcgt       900
     gtagtaagtt cgctaagcta g                                                 921
//

If you have problems or comments...

PBIL Back to PBIL home page