(data stored in ACNUC7421 zone)

EMBL: CR954246.MLTD

CR954246.MLTD        Location/Qualifiers
FT   CDS_pept        complement(306586..308055)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mltD"
FT                   /locus_tag="PSHAa0293"
FT                   /product="putative membrane-bound lytic murein
FT                   transglycosylase D [Precursor]"
FT                   /function="1.1.1 : Biosynthesis of murein sacculus and
FT                   peptidoglycan"
FT                   /EC_number="3.2.1.-"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homolgy; PubMedId : 10843862, 1663890; Product type e :
FT                   enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0293"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85392"
FT                   /db_xref="GOA:Q3IEX5"
FT                   /db_xref="InterPro:IPR000189"
FT                   /db_xref="InterPro:IPR008258"
FT                   /db_xref="InterPro:IPR018392"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="InterPro:IPR036779"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IEX5"
FT                   /protein_id="CAI85392.1"
FT                   /translation="MRSLVLACLGVFLFGCETTKPEPIEAPQIFTHFKPSYSAPSELKT
FT                   PQSTKTNLRITPPKNTKNKIITPPAKTTDLWQHIANNLHFPIEQNKALKKRINWYLQQP
FT                   DYLQVMSKRAAPYLYHIVKKVEQQQLPIELALLPFVESGFRPTAHSSQQAVGVWQLVGA
FT                   TAHHFGVKSDQWYDGRQDVLAATDAALAYLSYLYKRFDGNWLHALAAYNSGEGRVKRAI
FT                   KQNKKHGKSTDYWSLKLPQETADYVPKLLALSYLVKHPQQGFKRPKLAYKALTTHMNVG
FT                   QQFDFSIIAKLSGVGSKQLHALNQGYLKNQSSPNGPHTLLLPIEQQALLNSSFFKTNFA
FT                   GEYIVKQNDTLYSIARRFGMPLSTLKQLNNKQNNLIGIGEKLLVGQPKTLPESLTIDYK
FT                   ISPYLEHQEVVIATLEIDYEVQPGDTLWSISQLYNVPHSDLAKWNKLSASSMLKPGIQL
FT                   VLFIPQAEKPQVTTIKKDLLLDLQKTLNQPR"
     atgcgcagtt tggttttagc ttgtttaggt gtttttttat ttggctgtga aaccaccaag        60
     ccagagccta tagaagcacc gcaaatattt actcacttta agccaagtta cagcgcccct       120
     agtgaattaa aaacaccgca aagcacaaaa actaacttac gcataacgcc gcctaaaaat       180
     acaaaaaata agataataac gccaccggcc aaaacaactg acttatggca gcatatcgct       240
     aataatctgc attttcctat tgagcaaaat aaagcgctaa aaaagcgtat taattggtat       300
     ttgcagcaac ccgattacct gcaagttatg agcaaacgag ccgctccgta tttataccat       360
     attgtaaaaa aggtagaaca acagcaacta ccaatagagt tagcactgct gccttttgta       420
     gagagcggat ttagacccac tgcacactca tcgcagcaag ccgttggcgt atggcaactg       480
     gtaggagcaa ctgcacatca ttttggggtt aagtctgatc aatggtatga cggccgccaa       540
     gatgtacttg ccgccaccga cgcagcactg gcgtatttaa gttacttata taaacgcttt       600
     gatggcaatt ggctgcacgc tctcgccgct tataatagcg gtgaagggcg agttaaacgc       660
     gcgattaaac aaaataaaaa gcacggtaaa agcactgatt actggtcgct aaaattacct       720
     caagaaaccg ccgattatgt acccaagtta ctggcactaa gctacttagt taaacacccg       780
     caacaaggtt ttaaacgccc aaagctcgct tacaaagcat tgaccaccca tatgaatgta       840
     ggccaacaat ttgatttttc aatcattgcc aagctctctg gagtaggctc taagcagcta       900
     catgcactta atcaagggta tttaaaaaat caaagttcac ccaatggtcc gcatacgtta       960
     ttactgccaa ttgagcaaca ggcactatta aacagttcgt tttttaaaac taactttgct      1020
     ggagagtaca tagttaaaca aaacgatacg ctttacagta ttgctaggcg ctttggcatg      1080
     cctttaagta ccttaaagca acttaataat aaacaaaaca acttaattgg cattggtgaa      1140
     aaattacttg ttggccagcc caaaacactc ccggaatcat tgactattga ttataaaatt      1200
     agcccctacc ttgagcatca agaagtggta attgcaacac tcgaaataga ctatgaagtg      1260
     caaccaggcg ataccttgtg gagcattagt cagctttaca atgtgccgca cagtgaccta      1320
     gctaaatgga ataaactgtc agcgtcgagt atgctcaaac caggtattca attagtgtta      1380
     tttattcctc aagccgaaaa gcctcaagta acaacaatta aaaaagattt attgttagat      1440
     ctacaaaaaa cattaaatca gccacgttaa                                       1470
//

If you have problems or comments...

PBIL Back to PBIL home page