(data stored in ACNUC7421 zone)

EMBL: CR954246.MSCS

CR954246.MSCS        Location/Qualifiers
FT   CDS_pept        414580..415398
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mscS"
FT                   /locus_tag="PSHAa0396"
FT                   /product="putative mechanosensitive channel protein (MscS
FT                   family)"
FT                   /function="1.3.2 : Mechanosensors"
FT                   /function="4.1 : Adaptation to atypical conditions"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homolgy; PubMedId : 14671322, 15063854, 12767977; Product
FT                   type t : transporter"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0396"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85494"
FT                   /db_xref="GOA:Q3IIH3"
FT                   /db_xref="InterPro:IPR006685"
FT                   /db_xref="InterPro:IPR008910"
FT                   /db_xref="InterPro:IPR010920"
FT                   /db_xref="InterPro:IPR011014"
FT                   /db_xref="InterPro:IPR011066"
FT                   /db_xref="InterPro:IPR023408"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IIH3"
FT                   /protein_id="CAI85494.1"
FT                   /translation="MESVLNWLNENSGLILHYGIQAVIALVIFLLGGRIAKFCANLTEK
FT                   AFDKKKVDKAVGSFVSSIVFAIVFMATVLMALSQIGIETTSFIAILGAAGLAVGLALQG
FT                   SLSNFASGVLIILLRPFKSGDYVEAGNKAGTIKKIEIFSTELRTPDNKVIIMPNSKIMS
FT                   DAIVNYSRESTRRIDLVIRVDYDADLRKAKEVLKSILDSESRILKDPAYNVSVSELAES
FT                   SVNFIVRPWVESADYWPTYWSLLEEIKIIFDEQGINIPAPQMDVHLRKQD"
     atggaatcgg tactcaattg gcttaatgaa aactcaggcc taattttaca ctatggaata        60
     caagcggtaa tagcgctggt tatcttttta ttaggtgggc gaattgcaaa attttgtgca       120
     aacttaaccg aaaaagcatt cgacaaaaag aaagtagaca aagcagtagg ctcttttgtt       180
     tctagtattg tatttgccat agtatttatg gcgaccgttt taatggcgct atcgcaaata       240
     gggatcgaaa caacctcttt tatcgctatt ttaggtgctg ctggtttagc tgtaggttta       300
     gcactacaag gctctctttc taactttgca tcaggcgtgc tgattatttt actacgccct       360
     tttaaatcgg gcgactacgt agaggcaggt aataaagccg gcactattaa aaaaatcgaa       420
     atattttcaa cagagctgcg caccccagat aacaaagtta tcataatgcc aaattcaaaa       480
     atcatgtcag atgcaatcgt taattactca cgagagtcaa cacgccgtat agatttagta       540
     attcgtgtag attacgatgc cgatttacgc aaagcgaaag aagtgcttaa atcaatactc       600
     gatagcgagt cacgcatttt aaaagatccg gcttataacg tatcagtatc tgagcttgct       660
     gaatcaagcg taaactttat agttcgcccg tgggttgagt cagccgatta ttggcctacg       720
     tactggagtt tactcgaaga aattaaaatt atatttgatg agcaagggat caatattcca       780
     gctcctcaaa tggatgtaca tttacgcaaa caagattaa                              819
//

If you have problems or comments...

PBIL Back to PBIL home page