(data stored in ACNUC7421 zone)

EMBL: CR954246.MTNN

CR954246.MTNN        Location/Qualifiers
FT   CDS_pept        complement(561359..562066)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mtnN"
FT                   /locus_tag="PSHAa0547"
FT                   /product="5'-methylthioadenosine/S-adenosylhomocysteine
FT                   nucleosidase; MtnN"
FT                   /function="2.3.3 : Sugar-nucleotide biosynthesis and
FT                   conversions"
FT                   /EC_number="3.2.2.16"
FT                   /EC_number="3.2.2.9"
FT                   /note="Evidence 2b : Function of strongly homologous gene;
FT                   Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0547"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85635"
FT                   /db_xref="GOA:Q3ILJ7"
FT                   /db_xref="InterPro:IPR000845"
FT                   /db_xref="InterPro:IPR010049"
FT                   /db_xref="InterPro:IPR035994"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3ILJ7"
FT                   /protein_id="CAI85635.1"
FT                   /translation="MNVGIIGAMEPEVKILREAMQNPQTLTKAGFTFYTGELAGNTVTL
FT                   VQSGIGKVASTIATTLLIDNFAPDCVINTGSAGGFDPSLNVGDVVISSEVRHHDVDVTA
FT                   FGYEIGQVPQMPAGFAAHPKLVAAAEQTIAQISDVKTLVGLICTGDIFMCDPIRIEKAR
FT                   SDFPTMLAVEMEGASIAQTCHTLNTPFVVIRSMSDIAGKESPQSFEEYLETASINSSKM
FT                   VVALLEKLTAVSL"
     atgaatgttg gtattattgg cgcaatggag ccagaagtta aaattttgcg cgaagcaatg        60
     caaaatccac aaactttaac taaagctggt tttacttttt ataccggtga attagcaggt       120
     aacacagtaa cattggttca atctggtatt ggtaaagtag catcaactat tgcaactaca       180
     ttacttattg acaacttcgc ccctgattgc gtaattaaca ccggctctgc cggcggcttt       240
     gatccgtcat taaatgtggg cgatgtagtt atttcgtcag aagttcgtca tcatgatgtt       300
     gatgtaactg cctttggtta cgaaataggt caagtaccac aaatgccagc aggttttgca       360
     gcacacccta aattagtggc tgccgcagag caaactattg cgcaaattag tgacgtaaaa       420
     accttagttg gtttaatttg taccggcgac atatttatgt gtgacccaat acgtattgaa       480
     aaagctcgta gcgactttcc tacaatgctt gcagtagaaa tggaaggggc atcaattgcg       540
     caaacctgtc atacacttaa tacgccgttt gtggttattc gctcgatgtc agatattgcc       600
     ggcaaagagt cgccgcagtc gtttgaagaa tacctagaaa cagcatcaat caattcatct       660
     aaaatggtag tggcgttact tgaaaagcta acggcagttt cactgtaa                    708
//

If you have problems or comments...

PBIL Back to PBIL home page