(data stored in ACNUC7421 zone)

EMBL: CR954246.MURI

CR954246.MURI        Location/Qualifiers
FT   CDS_pept        264077..264874
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="murI"
FT                   /locus_tag="PSHAa0252"
FT                   /product="glutamate racemase"
FT                   /function="1.1.1 : Biosynthesis of murein sacculus and
FT                   peptidoglycan"
FT                   /EC_number="5.1.1.3"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 8098327; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0252"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85355"
FT                   /db_xref="GOA:Q3IDS7"
FT                   /db_xref="InterPro:IPR001920"
FT                   /db_xref="InterPro:IPR004391"
FT                   /db_xref="InterPro:IPR015942"
FT                   /db_xref="InterPro:IPR018187"
FT                   /db_xref="InterPro:IPR033134"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IDS7"
FT                   /protein_id="CAI85355.1"
FT                   /translation="MSAHIMVFDSGIGGTTVLEHIQQSIPDAQYSYFMDNALLPYGAQS
FT                   QQTIINRLCALIHFINQQALNVDLIVIACNTASTSALGAVRQITTIPIVGVVPAIKPAA
FT                   QLTQSKHIGLLATPATISSPYTRTLIQEHTNNIAVSLYSSVELVTLAERLFFEQSLDTT
FT                   KLHQELDRLNIDQSIDVLVLGCTHFPILAEPISQYFNRKVQLLDSGAAIAKRVHYLISQ
FT                   LNLTNNNIADTKKPLQYYATASVSSKLAVKLVTLIDPAQNEER"
     ttgtcagcgc acataatggt ttttgattca ggtattggtg gtactacggt acttgaacat        60
     attcagcaaa gtattccaga tgcgcaatac agctatttta tggataatgc gctattgcca       120
     tacggcgctc agtcacagca aacgattatt aaccgcttat gcgcactcat tcactttatt       180
     aaccagcaag cgcttaatgt agatttaatt gttattgcat gtaacaccgc ctctacttct       240
     gcgcttgggg cagtgcgcca aattactact attcctatag tgggggtggt accggcgata       300
     aaacctgctg cgcaacttac acaatctaaa catatcggcc tactggcaac tccagcaact       360
     atatcaagtc cctatacgcg cacactcata caagaacata ccaacaatat agcagttagc       420
     ttatatagta gcgttgaact agttacttta gccgagcgtc tgtttttcga acaaagttta       480
     gatacaacta aactgcacca agaactcgat cgtttaaaca tagatcagtc tatagatgta       540
     ttagtattag gctgtacgca ttttcctatt ttggcagagc cgattagtca gtactttaat       600
     aggaaagtgc agctacttga ttcaggtgca gcgattgcta agcgagttca ttacttaatt       660
     agccagctta atttaacgaa taacaatatt gcagatacaa aaaagccgct gcaatattat       720
     gcaacggcta gtgtgagtag taagttagct gtaaagctag ttacactgat tgatccggct       780
     cagaacgaag agcgttag                                                     798
//

If you have problems or comments...

PBIL Back to PBIL home page