(data stored in ACNUC7421 zone)

EMBL: CR954246.MUTL

CR954246.MUTL        Location/Qualifiers
FT   CDS_pept        282222..284078
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mutL"
FT                   /locus_tag="PSHAa0269"
FT                   /product="Enzyme in GATC methyl-directed mismatch repair,
FT                   stimulates binding of Vsr and MutS to heteroduplex DNA"
FT                   /function="3.1.4 : DNA proof-reading and repair"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 12887908; Product type f : factor"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0269"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85368"
FT                   /db_xref="GOA:Q3IDU0"
FT                   /db_xref="InterPro:IPR002099"
FT                   /db_xref="InterPro:IPR013507"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR014762"
FT                   /db_xref="InterPro:IPR014790"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR020667"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="InterPro:IPR037198"
FT                   /db_xref="InterPro:IPR038973"
FT                   /db_xref="InterPro:IPR042121"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3IDU0"
FT                   /protein_id="CAI85368.1"
FT                   /translation="MSIEILPARLANQIAAGEVVERPASVVKELVENSLDAGATRIQID
FT                   IERGGHKLIRIRDNGAGIAQDELTLALSRHATSKLKSLDDLENICSLGFRGEALASISS
FT                   VSRLTLSSKTKHQEAAWQAFAQGRDMAVQVKPVAHPDGTTIEVKDLFFNTPARRKFLRT
FT                   EKTEFSHIDELIKRIALSRFDVSITLTHNEKVVRQYRAKTDPSQAIARVAQVAGKAFAE
FT                   QGLHIQSGEGGLQLHGWVLPVGSANTVQYTYVNNRMMRDKLILHAIRQAFEEVSGAQEL
FT                   PGFVIYIDIDPRQVDVNVHPAKHEVRFHQGRLVHDFILQAIKQVVVPLQGEFTNEPLNN
FT                   LADTAFSQTDTARSPTGNFESGEVFDYPKSQLQPSHSVSSGGASLGSRSAGGSGGAYRA
FT                   TPSTNHHDINAFYQGVSEQHAAHFDQGAHVSVGVNQSHAVEQAVALKTVAIISINEGVC
FT                   VFSSEQQLYCSHFKYALVDDWHEQIKEQGSLEGKALLLPVRVNLSKQDCELIAAQQSWF
FT                   TLLGFELIIEKQFVMVKKLPACLYLLDVTSAVESLLEACKAPLENIESWLAWQMQHTPA
FT                   RFYSSNIFLAQQARMQNNPQTIERLRVKAVKIDIEHYLMQLD"
     atgagtattg aaatactacc cgcacgttta gcgaaccaaa ttgctgcagg tgaagtggtc        60
     gagcgccccg cgtcggtggt aaaagaatta gtagaaaaca gcctagatgc tggtgctaca       120
     cgcattcaaa tagatattga gcgaggtggg cacaaactaa ttcgtattcg tgacaatggt       180
     gcgggtattg ctcaagacga gcttacattg gcgctttctc gccatgcaac cagtaaattg       240
     aaatccctcg atgatttaga aaatatttgc tcactaggat ttagaggtga agcactggcg       300
     tcaattagtt ccgtttcgcg cttaacgcta agctcaaaaa ctaaacatca agaagccgct       360
     tggcaagcat ttgcacaagg ccgcgatatg gctgtgcaag taaaaccagt agcgcaccca       420
     gatggcacca ccatagaagt aaaagattta ttttttaata cgccagcccg gcgcaaattt       480
     ttacgtaccg aaaaaacaga gtttagccat attgatgagc ttataaagcg cattgcgctg       540
     agtcgatttg atgtatctat tacccttact cataatgaaa aagtggtcag gcagtaccgt       600
     gctaaaactg atcctagcca agcaattgcc cgtgtagcgc aagtggcggg taaagcattt       660
     gctgagcaag gcttgcatat tcaatcgggc gaggggggct tgcagctcca tggctgggta       720
     ttgccggttg gttctgctaa caccgtgcag tatacctatg taaataatcg tatgatgcgc       780
     gacaagctta tactgcacgc tattcgccaa gcatttgaag aagtaagtgg tgcccaagag       840
     ttacccggtt ttgttattta tattgatatt gaccctcgtc aagttgatgt aaatgttcat       900
     ccggcaaaac acgaagtacg ttttcatcaa gggcgtttag tacacgactt tatactacaa       960
     gcaattaaac aagttgttgt gccactgcaa ggtgagttta ctaatgagcc tttaaataac      1020
     ctagccgata cggcatttag tcagacagac actgcgcgtt ctcccactgg gaattttgag      1080
     tcgggtgagg tatttgatta tcctaaatcg caattgcaac catctcatag tgtcagttct      1140
     ggcggcgcat cgctaggttc gcgtagtgcg ggagggagtg gcggcgccta cagagctaca      1200
     cctagcacta atcatcatga tattaatgct ttttatcagg gcgtgagtga gcagcatgcc      1260
     gcgcattttg accaaggcgc tcacgtatct gttggggtta accagtcaca cgctgtggag      1320
     caggcagtgg ctttaaaaac ggttgctatt atcagcatca acgaaggcgt gtgtgtgttt      1380
     agcagcgagc agcaattgta ttgctcacat tttaaatatg cattagttga tgattggcat      1440
     gagcaaataa aagagcaggg cagcttagag ggcaaagcgc tgttgttgcc agtacgggtt      1500
     aatttatcca agcaagactg tgagctaata gcagcgcaac agtcgtggtt tacgctatta      1560
     ggttttgagc taattattga aaaacagttt gtgatggtta aaaaacttcc tgcgtgctta      1620
     tatttattag acgttactag cgcggttgaa agcctgctgg aagcgtgtaa agcaccactt      1680
     gaaaacatag aaagctggtt ggcgtggcag atgcagcaca caccagcgcg tttttattcc      1740
     agcaatatct ttttagcgca gcaagcccgc atgcaaaata atccgcaaac aattgaacgt      1800
     ttgcgtgtaa aagcagttaa aatagatata gagcactatt taatgcaatt agattaa         1857
//

If you have problems or comments...

PBIL Back to PBIL home page