(data stored in ACNUC7421 zone)

EMBL: CR954246.MUTM

CR954246.MUTM        Location/Qualifiers
FT   CDS_pept        467259..468035
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mutM"
FT                   /locus_tag="PSHAa0447"
FT                   /product="formamidopyrimidine DNA glycosylase"
FT                   /function="3.1.4 : DNA proof-reading and repair"
FT                   /EC_number="3.2.2.23"
FT                   /note="Evidence 2b : Function of strongly homologous gene;
FT                   PubMedId : 3053667; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0447"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85544"
FT                   /db_xref="GOA:Q3IEI2"
FT                   /db_xref="InterPro:IPR000214"
FT                   /db_xref="InterPro:IPR010663"
FT                   /db_xref="InterPro:IPR010979"
FT                   /db_xref="InterPro:IPR012319"
FT                   /db_xref="InterPro:IPR015886"
FT                   /db_xref="InterPro:IPR015887"
FT                   /db_xref="InterPro:IPR020629"
FT                   /db_xref="InterPro:IPR035937"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IEI2"
FT                   /protein_id="CAI85544.1"
FT                   /translation="MGITPHVLNQVVTKVNIHNGSMRWPVPDDVYQLTGLTVTGVERRA
FT                   KYLLLHCALGSTILHLGMSGNLRVVSANEPLKKHDHIEFIFANGKALRLNDPRRFGCCL
FT                   WQAPGSVHKLLAKLGPEPLTDEFFAKQVYQQSRNKKVPVKQFIMNNAIVVGVGNIYANE
FT                   SLFKAGIDPRREAGKVSLKSFEALIPIIKDTLAAAITQGGTTLKDFAQSDGKPGYFAQQ
FT                   LLVYGRKGQPCLVCKSELQEVRLGQRSTVFCGKCQK"
     atgggcataa ccccgcatgt tttaaatcaa gttgttacta aggtaaatat tcataatggc        60
     agcatgcgtt ggccggtgcc agacgatgta tatcagctaa caggtttaac cgtaacgggc       120
     gttgagcgcc gcgcaaaata tttgttatta cactgcgcgt taggctctac tattttgcat       180
     ttaggtatgt cgggcaattt acgtgtagta agtgctaacg agccacttaa aaaacacgat       240
     catatagaat ttatttttgc taacggtaaa gcgctgcgct taaacgatcc gcgccgcttt       300
     ggttgctgcc tatggcaagc gccgggctca gttcataagt tactggcaaa gctcgggcct       360
     gagccgctta ctgacgagtt ttttgcgaag caggtgtatc agcaatcgcg caataaaaaa       420
     gtgccggtaa aacaatttat aatgaataac gccatcgtcg taggggtcgg taatatttac       480
     gctaatgaat cgttatttaa agcgggaata gaccctcgcc gcgaagccgg taaagtatcg       540
     ctgaaaagtt ttgaagcgct tattcctata attaaagaca cgctagccgc ggcaataacc       600
     caaggtggca ctaccttaaa agattttgcc caaagcgacg ggaaaccggg ttactttgct       660
     cagcaacttt tagtgtacgg tcgtaaaggg caaccttgct tggtgtgtaa aagcgaatta       720
     caagaagtta ggctagggca aagaagtact gtgttttgtg ggaagtgtca gaagtga          777
//

If you have problems or comments...

PBIL Back to PBIL home page