(data stored in ACNUC7421 zone)

EMBL: CR954246.MUTY

CR954246.MUTY        Location/Qualifiers
FT   CDS_pept        569838..570896
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mutY"
FT                   /locus_tag="PSHAa0554"
FT                   /product="A/G-specific adenine glycosylase"
FT                   /function="3.1.4 : DNA proof-reading and repair"
FT                   /EC_number="3.2.2.-"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 2197596, 2001994; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0554"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85642"
FT                   /db_xref="GOA:Q3ILJ0"
FT                   /db_xref="InterPro:IPR000445"
FT                   /db_xref="InterPro:IPR003265"
FT                   /db_xref="InterPro:IPR004036"
FT                   /db_xref="InterPro:IPR005760"
FT                   /db_xref="InterPro:IPR011257"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR023170"
FT                   /db_xref="InterPro:IPR029119"
FT                   /db_xref="UniProtKB/TrEMBL:Q3ILJ0"
FT                   /protein_id="CAI85642.1"
FT                   /translation="MDLNKQQSDWFSNQVVDWYHLHGRKTLPWQLAKTPYKVWVSEVML
FT                   QQTQVVTVIPYFERFMQSFPDIIALANADEDQVLHHWTGLGYYARARNLHKTAKIVRDK
FT                   YQGQFPTTLEEVIDLPGIGRSTAGAVLSLSLGQHHPILDGNVKRVLARFFMVEGWYGVK
FT                   KVESQLWHLSEQLTPKNNVTEFNQAMMDLGSSLCSRSRFDCPACPLSSRCGAFKTQQVK
FT                   TFPHSKPKKAVPKKSCHQLIIKHDDKVLMEKRPNSGIWGGLFGFFEFNELSELEVFIAQ
FT                   QGLTADLVALEPFTHIFSHFELTINPHVLNIVQIPDVINDRQLVWYPLAQSIEVGLAAP
FT                   TKKLVKQIAPIG"
     ttggatttaa ataaacagca gtctgattgg ttttctaacc aagtggttga ttggtatcat        60
     cttcatggta gaaaaacgct gccgtggcag ttagcaaaaa caccctataa agtatgggtg       120
     tctgaagtga tgttacaaca aactcaagta gtgaccgtta tcccttattt tgaaaggttt       180
     atgcaaagct ttcccgatat tattgcttta gctaacgccg atgaagatca ggtgctgcat       240
     cactggactg gtttagggta ttacgcaagg gcacgtaact tacataaaac agctaaaata       300
     gttcgtgaca agtatcaggg gcagtttcct acaacgcttg aagaggttat tgatttaccc       360
     ggaatagggc gctctacagc cggtgcagtg ttatcacttt cacttgggca gcatcacccc       420
     atactcgatg gtaatgttaa acgagtatta gcccgttttt ttatggttga aggctggtat       480
     ggtgttaaaa aagtcgaaag ccaactttgg catttgagcg agcagctaac gcctaaaaat       540
     aacgtaaccg agtttaatca agctatgatg gatttaggct cgagcttatg ttcgcgtagt       600
     cgttttgact gccctgcatg tccgttaagt agccgctgtg gtgcatttaa aacgcagcag       660
     gtaaaaacat tcccacactc aaaacctaaa aaagcagtgc cgaaaaaaag ctgccatcag       720
     ttaattatta aacatgatga taaagtgctc atggaaaaac ggcctaactc aggaatatgg       780
     ggcgggttgt ttggcttttt tgagtttaat gaattgagcg aactagaggt gtttatagcg       840
     cagcaagggc taacagctga cttagtggcg cttgaaccct ttacccatat attttcgcac       900
     tttgaactta ctattaatcc acatgtgcta aatatagtac aaattccaga tgtaattaac       960
     gaccgacaat tagtttggta cccactagct cagtcaattg aggtgggttt agcagcacca      1020
     actaaaaagt tggttaaaca aattgcacca ataggttag                             1059
//

If you have problems or comments...

PBIL Back to PBIL home page