(data stored in ACNUC7421 zone)

EMBL: CR954246.NADC

CR954246.NADC        Location/Qualifiers
FT   CDS_pept        complement(400100..400945)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nadC"
FT                   /locus_tag="PSHAa0386"
FT                   /product="nicotinate-nucleotide pyrophosphorylase"
FT                   /EC_number="2.4.2.19"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 8561507; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0386"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85484"
FT                   /db_xref="GOA:Q3III3"
FT                   /db_xref="InterPro:IPR002638"
FT                   /db_xref="InterPro:IPR004393"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR022412"
FT                   /db_xref="InterPro:IPR027277"
FT                   /db_xref="InterPro:IPR036068"
FT                   /db_xref="InterPro:IPR037128"
FT                   /db_xref="UniProtKB/TrEMBL:Q3III3"
FT                   /protein_id="CAI85484.1"
FT                   /translation="MPIPHTLVSQLVTLALGEDLNYQSAENGDITAQLIPVNEQANAKV
FT                   ITREDCIFCGKDLIIEVFKQVDPSVVVNVLVNDGDAVKANSTLFTATGSARAILTAERT
FT                   ALNFVQTLSGTATTTAHYVKELAGTKTQLLDTRKTIPGLRILQKYAVKCGGGANHRIGL
FT                   YDAFLIKENHIAACGGINKAVAQAKQNQPNKPIEVEVESLVDLKQALDAGADIIMLDNF
FT                   NVEQIKQAVVVTNKRAKLEVSGNMTLQTLKTYSQAGVDFISSGALTKNLQSIDLSMRFD
FT                   "
     atgcctattc cacacacttt agttagtcaa ctagttactc ttgcacttgg tgaagattta        60
     aattaccaaa gtgctgaaaa tggcgacatt accgcgcaac ttattcctgt aaacgagcaa       120
     gcgaacgcta aagtaattac ccgcgaagac tgcatatttt gtggtaaaga cctaattatt       180
     gaagtattta agcaagtaga tccaagcgtt gtagtaaatg tactagtaaa cgatggcgat       240
     gcagttaaag ctaacagtac tttatttaca gcaacaggct cggctcgcgc tattttaact       300
     gccgagcgta cagcacttaa ctttgtacaa acactttcgg gtactgctac taccacagct       360
     cattatgtaa aagaacttgc gggtacaaaa acccagctac tcgatacccg taaaaccata       420
     cctggtttac gcattttaca aaagtacgcc gttaaatgtg gcggcggtgc aaaccaccgt       480
     attggtttat acgacgcgtt tttaataaaa gaaaatcaca tagcagcgtg tggcggtata       540
     aacaaagccg tggcgcaagc taaacaaaac caaccaaaca aaccaataga agtagaagtt       600
     gaatcacttg ttgatctaaa acaagcgctt gatgcgggtg ccgatattat aatgctcgac       660
     aactttaacg tagagcaaat taaacaagct gtagtggtta ctaacaaacg tgcaaaactt       720
     gaggtttcgg gcaatatgac cctacaaacg cttaaaactt actcacaagc tggggtagac       780
     tttatatcaa gcggagcgtt aacaaaaaac ttacaatcaa tcgatttatc aatgcgattt       840
     gattaa                                                                  846
//

If you have problems or comments...

PBIL Back to PBIL home page