(data stored in ACNUC7421 zone)

EMBL: CR954246.NADE

CR954246.NADE        Location/Qualifiers
FT   CDS_pept        complement(76850..77686)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nadE"
FT                   /locus_tag="PSHAa0075"
FT                   /product="NAD synthetase"
FT                   /function="2.5.11 : Pyridine nucleotides"
FT                   /EC_number="6.3.5.1"
FT                   /note="Evidence 2b : Function of strongly homologous gene;
FT                   PubMedId : 8195100; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0075"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85184"
FT                   /db_xref="GOA:Q3IF87"
FT                   /db_xref="InterPro:IPR003694"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR022310"
FT                   /db_xref="InterPro:IPR022926"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3IF87"
FT                   /protein_id="CAI85184.1"
FT                   /translation="MRAEIMAAMKVQPVIDVNAEISRRVNFIKARLIAAHATSLVLGIS
FT                   GGVDSSVCGRLCQLAVNELNQEQSTTDYKFVAVRLPYGVQADENEAQLAVDFIQPSSRM
FT                   TVNIKPATDALHEQTMAAIVGNGESLPEQEKIDFIKGNVKARQRMIAQYEIAAFCQGLV
FT                   VGTDHSAENITGFYTKFGDGACDLAPLFGLSKRQVRALGSTLGASSVLVNKAPTADLES
FT                   DRPGLTDEEALGLSYEQIDDFLEGKPVTQQVEQTLSAIYQRTQHKRQPVPTIYDEL"
     atgcgcgccg agattatggc tgcaatgaaa gtgcagccag ttattgatgt aaatgctgaa        60
     attagccgtc gtgttaactt tattaaagcc cgcttaatag cagcccatgc aacgtctttg       120
     gtattaggta ttagtggtgg agtcgactct tcagtgtgcg gccgtttatg ccaacttgct       180
     gttaatgaac ttaaccaaga gcaaagcact actgattata aatttgttgc tgtgcgttta       240
     ccttacggtg tgcaagccga cgaaaatgaa gcgcaactag cggttgattt tattcaacct       300
     agcagccgca tgacagtaaa tattaagcct gcaaccgatg cgctacacga acaaacaatg       360
     gcggctattg ttggtaacgg tgagtcactc cctgagcaag aaaaaattga ttttattaag       420
     ggtaatgtta aagcccgtca acgcatgatt gcacaatacg aaattgctgc attttgccaa       480
     ggtttagtgg ttggcaccga tcacagtgcc gagaatatta ccggctttta taccaagttt       540
     ggtgatggcg cttgtgacct tgcaccgctt tttggcttat ctaaacgcca agtgcgcgct       600
     ttaggtagta cattaggtgc ttcgtctgta ttagttaata aagcacctac cgcagattta       660
     gaaagtgatc gcccaggact taccgacgaa gaagcgttag gtttaagtta tgagcaaatt       720
     gatgactttt tagaaggtaa accggttacg caacaggttg aacaaacact tagcgctatt       780
     tatcagcgta cgcaacataa gcgtcaacca gtgccaacta tatacgatga gctttaa          837
//

If you have problems or comments...

PBIL Back to PBIL home page