(data stored in ACNUC7421 zone)

EMBL: CR954246.NUDE

CR954246.NUDE        Location/Qualifiers
FT   CDS_pept        135981..136592
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nudE"
FT                   /locus_tag="PSHAa0127"
FT                   /product="ADP compounds hydrolase nudE"
FT                   /EC_number="3.6.1.-"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 9452430, 11567017; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0127"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85231"
FT                   /db_xref="GOA:Q3IDG0"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR020084"
FT                   /db_xref="InterPro:IPR020476"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IDG0"
FT                   /protein_id="CAI85231.1"
FT                   /translation="MIKHNCHDSKLTPMTQKKHPIPPQILSNKVVAKSRLFTVESLELK
FT                   FSNNEERQYERIRGGGRGAVMIVPLTKDNELLLVREYCAGTNDYQLGFPKGLIDPGETP
FT                   EQAANRELKEEVGFGADYLKRLKAVSIAPSHFNTTMHIMVAKQLYSQTLPGDEPEPLVV
FT                   VKWPLTDWRSLLTQDDFTEARSVAALLLLDQYLASGVIDE"
     atgattaagc acaactgcca tgatagcaaa ttaacgccaa tgacacagaa aaagcaccct        60
     ataccaccgc aaatcctcag taataaagtt gtagctaaaa gtcgcttatt taccgtggaa       120
     tctttagaac ttaaattctc taataacgaa gaacgtcaat atgagcgaat tcgtggcggc       180
     gggcgaggtg cagtaatgat tgtgccgtta actaaagata acgaattact actagtgcga       240
     gaatattgcg ctggtactaa cgactatcaa ctgggttttc ctaaagggtt aattgaccca       300
     ggtgaaacac cagagcaagc cgctaatcgc gaacttaaag aagaagttgg ttttggtgca       360
     gattacctaa aacgattaaa agcggtatct atagcgccaa gtcattttaa taccaccatg       420
     cacattatgg tcgctaaaca attgtattca caaacattgc ccggtgatga gccagagcca       480
     ctggtcgttg ttaagtggcc attaaccgat tggcggtcat tattaacaca agacgatttt       540
     accgaagcac gcagtgtagc tgctttatta ttattagatc agtatttagc atcaggagtc       600
     attgatgaat aa                                                           612
//

If you have problems or comments...

PBIL Back to PBIL home page