(data stored in ACNUC7421 zone)

EMBL: CR954246.OADA

CR954246.OADA        Location/Qualifiers
FT   CDS_pept        552979..554760
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="oadA"
FT                   /locus_tag="PSHAa0539"
FT                   /product="oxaloacetate decarboxylase, alpha subunit"
FT                   /function="1.2.4 : Cations"
FT                   /EC_number="4.1.1.3"
FT                   /note="Evidence 2b : Function of strongly homologous gene;
FT                   PubMedId : 1331067; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0539"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85628"
FT                   /db_xref="GOA:Q3ILE6"
FT                   /db_xref="InterPro:IPR000089"
FT                   /db_xref="InterPro:IPR000891"
FT                   /db_xref="InterPro:IPR001882"
FT                   /db_xref="InterPro:IPR003379"
FT                   /db_xref="InterPro:IPR005776"
FT                   /db_xref="InterPro:IPR011053"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:Q3ILE6"
FT                   /protein_id="CAI85628.1"
FT                   /translation="MAKLKLTELVLRDAHQSLLATRMRLDDMLPIAKKLDDAGYWSIES
FT                   WGGATFDSCIRYLGEDPWERIRALKKAMPNTKQQMLLRGQNLLGYRHYADDVVEKFVER
FT                   AHKNGVDVFRIFDAMNDVRNLETAIKAAIKVGAHAQGTISYTVSPVHTLDMWLTLAKQL
FT                   EDLGCHSICIKDMAGLLKPYDAEKLIKALKETVSIPIAMQCHATTGLSTATYQKAIDAG
FT                   IDMLDTAISSMSMTYGHTATETIVSIVEGTERDTELDLNHLEEIAAYFRDVRKKYAAFE
FT                   GSLKGVDGRILLAQVPGGMLTNMENQLKEQGAADKLNEVLLEIPRVREDLGFLPLVTPT
FT                   SQIVGTQAVLNVLTGERYKTITKETAGVLKGEYGLTPAPMNKELQERVLDGAEVITCRP
FT                   ADNIAPELATLEAELLKEVQEQGLTLADEQIDDVLTYALFPQVGLKFIKNRNNPDAFEP
FT                   VPCVEDKSNKAPSKSASNNNSVKAEQYSVKVDGKVYDVVVAQGGELKEVTLKDSEHIPQ
FT                   SASVASGETLNAPLAGNIFKIKVKAGQVVNEGDVVIIMEAMKMETEIRATHTGTIAEVL
FT                   VGEGDAVTTGDAMIALA"
     atggctaaat taaaattaac agaactggta ctacgtgatg cgcatcaatc attgttagca        60
     actcgtatgc gccttgacga tatgctaccg attgcaaaaa agcttgatga tgcaggttat       120
     tggtctattg agtcgtgggg tggagctacg tttgattcgt gtattcgtta tttaggtgaa       180
     gatccttggg agcgtattcg cgcactaaaa aaagcgatgc caaatactaa acagcaaatg       240
     ctattacgcg gtcaaaattt attaggttac cgccattatg ctgacgatgt agtagaaaaa       300
     tttgtagagc gtgcccataa aaatggcgtt gatgtatttc gtatatttga tgcaatgaac       360
     gatgtacgta atcttgaaac ggcaattaaa gcggctataa aagtaggcgc acatgcccaa       420
     gggactattt cttatacagt aagccctgtt catacgcttg atatgtggtt aacgctagct       480
     aagcagttgg aagatttagg ctgtcattca atttgtatta aagatatggc gggtttatta       540
     aagccgtacg atgctgaaaa actaattaaa gcactaaaag aaactgtatc tattccaatt       600
     gcaatgcagt gccacgccac aacaggttta agtactgcga cttatcaaaa agcgattgat       660
     gcaggcattg atatgcttga taccgcaatt tcatctatga gtatgactta cggacacacc       720
     gcaactgaaa ctattgtatc gatagttgaa gggactgagc gtgatactga gcttgattta       780
     aatcaccttg aagaaattgc tgcttacttt agagatgtac gtaaaaaata cgcggcattt       840
     gaaggtagct taaaaggggt tgatggccgt attttactcg cgcaagtacc tggtggcatg       900
     ttaactaaca tggaaaacca gcttaaagag caaggcgcag cagataagct taatgaagtt       960
     ttacttgaga tcccacgtgt acgtgaagat cttggctttt taccgcttgt tacaccaacg      1020
     tcgcaaattg taggcactca agcggtactt aatgtactaa cgggtgagcg ctataaaaca      1080
     attactaaag aaacagctgg cgtattaaaa ggtgaatatg gcctaacacc agcacctatg      1140
     aataaagagc tacaagagcg tgtgcttgat ggagcagagg taattacttg tcgtcctgca      1200
     gataatattg cacctgagct tgcaacgctt gaggctgaat tattaaaaga agtacaagag      1260
     caaggtttaa ctcttgctga tgagcaaatt gatgacgtac taacgtatgc attattccca      1320
     caggttggtt tgaagtttat taaaaaccgt aacaacccag atgcatttga gccagttcct      1380
     tgtgttgaag ataaaagtaa taaagctccc tctaaatcag cttcaaataa caacagcgtt      1440
     aaagctgagc aatacagcgt aaaagtagac ggtaaggttt acgacgttgt tgtagctcaa      1500
     ggcggcgagc ttaaagaagt tacattaaaa gactcagaac atattcctca gtctgcttcg      1560
     gttgcatcag gcgaaacact taacgcccct ttagccggta atatttttaa gataaaggta      1620
     aaagcagggc aagttgtgaa tgaaggtgat gtagtgatta ttatggaagc catgaaaatg      1680
     gaaactgaaa tacgcgctac gcacaccgga acaattgctg aagtgttagt tggtgaaggc      1740
     gatgctgtaa ctaccggcga cgctatgatt gcattagctt ag                         1782
//

If you have problems or comments...

PBIL Back to PBIL home page