(data stored in ACNUC7421 zone)

EMBL: CR954246.OADB

CR954246.OADB        Location/Qualifiers
FT   CDS_pept        554774..555904
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="oadB"
FT                   /locus_tag="PSHAa0540"
FT                   /product="Oxaloacetate decarboxylase, beta subunit"
FT                   /function="1.2.4 : Cations"
FT                   /EC_number="4.1.1.3"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 2549031; Product type t : transporter"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0540"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85629"
FT                   /db_xref="GOA:Q3ILE5"
FT                   /db_xref="InterPro:IPR005661"
FT                   /db_xref="UniProtKB/TrEMBL:Q3ILE5"
FT                   /protein_id="CAI85629.1"
FT                   /translation="MDGILNLWHATGIANFTFPALIMIAVGCLLLFLAIAKKFEPLLLL
FT                   PIGFGAILTNIPVAGLSDPGGLLHYVYYVGIDTGIFPLLIFMGVGALTDFSALIANPRM
FT                   LLLGAAAQFGIFATLFGAILLNYVPGFEFSLQDASAIAIIGGADGPTAIFLASKLAPDL
FT                   LGAIAVAAYSYMALVPIIQPPIMRALTTVEERQIKMPELRKVSKKEKIIFPLMVLSLTA
FT                   MFLPAAIPLVGMFCLGNLMRESGVVDRLSNSAQNEIINVTTIFLGLAVGSKLAADKFLT
FT                   VETIGILVLGALAFAIGTASGVFMAKGLNKISKTPINPLIGAAGVSAVPMAARVVNKVG
FT                   LESNPHNFLLMHAMGPNVAGVLGSAVAAGILLALVG"
     atggatggta ttttaaacct ctggcatgcc acaggcattg ctaactttac atttccagcg        60
     ttgattatga ttgcggtagg ctgtttatta ttgtttttgg caatagccaa aaaatttgag       120
     cccctattat tattacctat cggctttggt gcaatattaa ctaatattcc ggtggctggt       180
     ttatccgacc ccggcggctt actgcattat gtgtattacg taggtattga tacggggatt       240
     tttccactat taatatttat gggagtaggc gcgttaactg attttagtgc gctaattgct       300
     aaccctcgta tgttgctatt aggtgcggct gcacagtttg gtatttttgc gactttgttt       360
     ggcgctattt tacttaacta tgtacctggt tttgaattta gcctgcaaga tgcgtcggct       420
     attgcaataa ttggtggagc tgatggccca accgctatat ttttagcctc taaactggca       480
     cccgacttgt taggtgcgat tgcggtagct gcttattcgt atatggcatt agtgccaatt       540
     attcagccgc caattatgcg cgcattaacc acggttgaag agcgccaaat aaaaatgcca       600
     gagctgcgta aagtatctaa aaaagagaaa attatttttc cattaatggt acttagctta       660
     acggctatgt ttttaccggc agctataccg ctggtaggta tgttttgttt aggtaactta       720
     atgcgagagt cgggtgttgt tgatagatta agtaacagtg ctcaaaacga aatcatcaat       780
     gttacaacta tatttttagg tttagctgta ggctcaaagc ttgctgcaga taagttttta       840
     actgttgaga cgattggtat tttagtgctt ggcgcactgg cttttgcaat tggtacggca       900
     tctggcgtat ttatggcgaa agggttaaat aaaatatcta aaacgccgat taatccatta       960
     ataggtgctg cgggagtatc ggctgtaccc atggcggcgc gcgtagtaaa taaagtaggc      1020
     cttgagagca atccgcataa ctttttactt atgcatgcaa tggggccaaa tgttgccgga      1080
     gtactaggca gtgcagttgc agcaggtatt ttattagcac ttgttggcta a               1131
//

If you have problems or comments...

PBIL Back to PBIL home page