(data stored in ACNUC7421 zone)

EMBL: CR954246.OADG

CR954246.OADG        Location/Qualifiers
FT   CDS_pept        552721..552966
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="oadG"
FT                   /locus_tag="PSHAa0538"
FT                   /product="putative oxaloacetate decarboxylase, gamma
FT                   subunit"
FT                   /function="1.2.4 : Cations"
FT                   /EC_number="4.1.1.3"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homolgy; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0538"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85627"
FT                   /db_xref="GOA:Q3ILE7"
FT                   /db_xref="InterPro:IPR005899"
FT                   /db_xref="InterPro:IPR023424"
FT                   /db_xref="UniProtKB/TrEMBL:Q3ILE7"
FT                   /protein_id="CAI85627.1"
FT                   /translation="MDIAALLTTASNLMLTGMVGVFVFLSLLITCVTVMSKLVSRFAEP
FT                   ELAMPARTPSFKSQGVPNEHIAAISAAIAQYKTNNN"
     atggatatcg ctgctttact tacaacagca agcaacttaa tgctaaccgg tatggtgggg        60
     gtgtttgtgt ttctgtcatt attaattacc tgcgttacgg ttatgtctaa gctggtatct       120
     cgctttgcag agcctgagct tgcaatgcct gccagaacac cgtcttttaa atcacaaggt       180
     gtgcctaatg agcacatcgc cgcaattagt gctgccattg ctcagtacaa aacaaacaat       240
     aattaa                                                                  246
//

If you have problems or comments...

PBIL Back to PBIL home page