(data stored in ACNUC7421 zone)

EMBL: CR954246.ORN

CR954246.ORN         Location/Qualifiers
FT   CDS_pept        505919..506464
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="orn"
FT                   /locus_tag="PSHAa0488"
FT                   /product="oligoribonuclease"
FT                   /function="3.2.2.2 : Ribonucleases"
FT                   /EC_number="3.1.-.-"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 9573169; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0488"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85584"
FT                   /db_xref="GOA:Q3IG97"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR013520"
FT                   /db_xref="InterPro:IPR022894"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3IG97"
FT                   /protein_id="CAI85584.1"
FT                   /translation="MNINKSNLIWLDLEMTGLEPETDKILEIATVVTDADLNILAEGPT
FT                   IAIHQSNELLDNMDEWCTTQHGKSGLTARCKASTYDEAYAVEQTIAFLKQWVPAGASPM
FT                   CGNSIGQDRRFMNKYMRELEDFFHYRNLDVSTIKELARRWKPEVLAQVNKKGSHLALDD
FT                   IKDSIMELKVYREKFFNL"
     atgaatatta ataaatcaaa cttaatttgg ctcgatcttg aaatgaccgg actcgaacca        60
     gagaccgata aaatactcga aattgcgacc gttgtcactg atgctgattt gaatatatta       120
     gctgaagggc caactattgc cattcatcaa agtaatgagt tgcttgataa tatggatgag       180
     tggtgtacca ctcagcatgg aaaatcgggt ttaacagcac gctgcaaggc aagtacttac       240
     gacgaagcat atgcggttga gcaaacaata gcctttttaa aacaatgggt acctgcaggt       300
     gcatcaccga tgtgtggtaa ctcaataggg caagatcgtc gctttatgaa taaatacatg       360
     cgcgaattgg aagacttttt tcactatcgt aatctagatg taagcacaat taaagagctc       420
     gcgcgtcgct ggaaaccaga ggtacttgca caagtgaata aaaaaggctc acatcttgcg       480
     ctagacgaca ttaaagattc gattatggaa ttaaaggtct atagagaaaa attctttaat       540
     ttataa                                                                  546
//

If you have problems or comments...

PBIL Back to PBIL home page