(data stored in ACNUC7421 zone)

EMBL: CR954246.OSMY

CR954246.OSMY        Location/Qualifiers
FT   CDS_pept        341380..341943
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="osmY"
FT                   /locus_tag="PSHAa0325"
FT                   /product="putative hyperosmotically inducible periplasmic
FT                   protein"
FT                   /function="4.1 : Adaptation to atypical conditions"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homolgy"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0325"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85424"
FT                   /db_xref="InterPro:IPR007055"
FT                   /db_xref="InterPro:IPR014004"
FT                   /db_xref="UniProtKB/TrEMBL:Q3ILB2"
FT                   /protein_id="CAI85424.1"
FT                   /translation="MKTFNKSIIAALVLGTTAMGAQASSWENESKDAWIDGKAETVLLM
FT                   NTNLNNFDINTDVKNGKVILTGKVNSELDKELAEELVLSLDGVTDVDNQLTVVKNMNSK
FT                   SHDNMKDDDGSGLTDAKITTVITTRYLFNSEVGGTNIDVDTDNGVVTLTGTVNSDAEKQ
FT                   LAVKIAKNAEDVRDVVDKLTIVAK"
     atgaaaacat ttaacaaatc tatcattgcg gcgttagttt taggtactac ggctatgggt        60
     gctcaagcga gcagctggga aaatgaaagt aaagatgctt ggattgatgg taaggctgaa       120
     acagtgcttc ttatgaacac taacctcaat aactttgaca tcaacactga tgtaaaaaat       180
     ggcaaagtta tactaacagg taaagttaat agcgaactcg acaaagagtt agcagaagaa       240
     cttgtactga gtttagatgg tgtaaccgat gttgataacc agcttactgt tgtgaaaaac       300
     atgaacagta aaagccatga caacatgaaa gatgatgatg gtagcggctt aaccgacgct       360
     aaaattacca cagtcatcac aacgcgttat ttatttaact cagaagttgg tggtacaaac       420
     attgatgtag atactgacaa cggtgtagtt actcttaccg gtacagtgaa ctcagatgct       480
     gaaaaacagc ttgcagtaaa aattgctaaa aatgctgaag atgttcgcga cgtagtagat       540
     aaactaacga tagttgcaaa gtaa                                              564
//

If you have problems or comments...

PBIL Back to PBIL home page