(data stored in ACNUC7421 zone)

EMBL: CR954246.PABA

CR954246.PABA        Location/Qualifiers
FT   CDS_pept        203138..203719
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pabA"
FT                   /locus_tag="PSHAa0192"
FT                   /product="putative glutamine amidotransferase; putatively
FT                   involved in paraminobenzoate biosynthesis"
FT                   /function="2.5.2 : Folic acid"
FT                   /EC_number="4.1.3.27"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homolgy; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0192"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85295"
FT                   /db_xref="GOA:Q3IFU1"
FT                   /db_xref="InterPro:IPR006221"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IFU1"
FT                   /protein_id="CAI85295.1"
FT                   /translation="MLLMIDNYDSFTYNLVQYFQRLDQEVLVKRNDQITLSQIKQLNPQ
FT                   HIVISPGPKSPSEAGISLSIVEQLKGQYPILGICLGHQTIAQALGAKVVRAKKVMHGKT
FT                   SPIYHSDQGVFKGLAKPLTVCRYHSLIVEAQSLPKELQVTAWTQTQQGEFDEIMGLLHT
FT                   DLALEGVQFHPEAILTEQGLALLDNFLTRF"
     atgcttttaa tgatcgacaa ttacgactcg tttacctata acttggtaca gtactttcag        60
     cgtttagatc aagaggtact ggttaagcgc aacgaccaaa taacgcttag ccaaattaag       120
     cagttaaatc ctcaacatat tgttatatca cccggtccta aaagcccaag cgaagcgggt       180
     atttcattaa gtattgttga gcaattaaaa gggcagtatc ctattttagg aatttgctta       240
     gggcatcaaa ctattgccca agccttagga gcaaaggtgg tgcgtgctaa aaaagtaatg       300
     cacggtaaaa catcgccaat ttaccatagc gatcaaggag tatttaaagg tttagctaag       360
     cccttaacgg tctgtcggta tcattcttta attgttgagg cacagtcgct gcctaaagag       420
     ttgcaagtaa cagcctggac acaaacccag caaggtgagt ttgacgaaat tatgggatta       480
     ttacatacag acttagcact tgaaggtgta caatttcatc cggaagctat tttaactgag       540
     caaggtttag cgttacttga taacttttta actcgcttct aa                          582
//

If you have problems or comments...

PBIL Back to PBIL home page