(data stored in ACNUC7421 zone)

EMBL: CR954246.PCK

CR954246.PCK         Location/Qualifiers
FT   CDS_pept        complement(241543..243084)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pck"
FT                   /locus_tag="PSHAa0228"
FT                   /product="phosphoenolpyruvate carboxykinase"
FT                   /EC_number="4.1.1.49"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; Product
FT                   type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0228"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85331"
FT                   /db_xref="GOA:Q3ILP3"
FT                   /db_xref="InterPro:IPR001272"
FT                   /db_xref="InterPro:IPR008210"
FT                   /db_xref="InterPro:IPR013035"
FT                   /db_xref="InterPro:IPR015994"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3ILP3"
FT                   /protein_id="CAI85331.1"
FT                   /translation="MTSSATRFVDLTAAELVEHAIRRGEGTLAANGAFVANTGHRTGRS
FT                   PKDRFIVQESSTENEIQWGNVNRPFDADKFDALWARVEAYVQSNDHFISHLEVGADPEH
FT                   YLPVVVTTETAWHHIFAKNMFIQPKSYNSSDVPQWQVMNVPSFVCEPERDGTNSDGTVL
FT                   INFAQRKVLLAGMRYAGEMKKSMFSVQNFLLPAKGVLPMHCSANVGEAGDTALFFGLSG
FT                   TGKTTLSADPTRFLIGDDEHGWAPGSVFNIEGGCYAKCIDLSQKNEPVIWDAIRFGTIL
FT                   ENVVLDENRVPDFNDTSLTQNSRAAYPLEHVEKRKVENRAGEPKAVVFLTCDVSGVLPP
FT                   VSILTEEAAAFHFLSGYTAKVGSTEIGSTSDIESTFSTCFGAPFFPRPAGVYAELLMKR
FT                   VREFGAKVYLVNTGWTGGPYGTGKRFDIPTTRAVVDAIVSGKLVGVETQHIDVLNLDVP
FT                   VAVPGVDSNLLNPINTWEDKAKYAEYAAKLAADFTENFTKYDVSDEIKNAGPKAQ"
     atgacttcaa gcgctactcg ttttgtcgat ctaactgcag ctgaacttgt cgaacacgcg        60
     atccgtcgtg gcgagggtac tttagcagcc aatggtgctt ttgtagcaaa tactggtcat       120
     cgcaccggtc gttctccaaa agatcgcttt attgttcaag aatctagtac tgaaaacgaa       180
     atccaatggg gcaacgtaaa tcgcccattc gacgcagata agtttgatgc tttgtgggca       240
     cgcgtagaag cgtatgtaca aagtaatgat cacttcatct ctcaccttga agtaggcgct       300
     gatccagagc actatctacc tgttgttgtt actacagaaa ctgcatggca tcatattttt       360
     gctaaaaata tgtttattca acctaaatct tacaactcat ctgacgtacc tcagtggcaa       420
     gtaatgaacg ttccttcatt tgtatgtgag cctgagcgcg atggcacaaa cagtgacggt       480
     acggtactca ttaactttgc acaacgcaaa gtgttacttg ctggtatgcg ttatgccggt       540
     gaaatgaaaa aatcaatgtt ctctgtacag aacttcctac ttccagcgaa aggtgtatta       600
     ccaatgcact gctctgcaaa cgtaggtgaa gcaggcgata ccgctttatt ctttggctta       660
     tctggtacag gtaaaacaac actttcagca gatccaactc gctttttaat tggcgatgac       720
     gaacacggct gggcacctgg tagtgtgttt aacattgaag gcggctgtta cgctaaatgt       780
     atcgacctat cacaaaaaaa tgaacctgtt atttgggatg cgatccgctt tggtactatt       840
     ttagaaaacg tagtgcttga tgaaaatcgt gtacctgatt ttaacgatac tagccttaca       900
     caaaatagcc gtgctgcgta ccctcttgag cacgttgaaa aacgtaaagt agaaaaccgc       960
     gcaggcgagc caaaagcagt ggtattttta acgtgtgacg taagtggtgt acttcctcca      1020
     gtatcaatat tgactgaaga agcggcagca tttcacttct taagtggcta cactgcaaaa      1080
     gtaggctcta ctgagattgg ttctacaagc gatattgagt caacattctc aacttgtttt      1140
     ggcgcaccat tcttcccacg tccagcaggt gtttatgctg agcttctaat gaagcgtgta      1200
     cgtgagtttg gcgctaaagt atacctagtt aacacaggtt ggactggcgg cccttacggt      1260
     actggtaagc gttttgatat tccaactaca cgtgctgtag tagatgctat tgtatcgggt      1320
     aaactagttg gcgtagaaac tcaacacatt gatgttttaa acctagacgt acctgtagcc      1380
     gttccaggtg tagacagcaa cttacttaac ccaattaata cctgggaaga caaagctaag      1440
     tatgctgaat atgcagctaa acttgcagcc gatttcactg aaaacttcac taaatatgac      1500
     gtatcagacg aaattaaaaa tgcaggacct aaagcacaat ag                         1542
//

If you have problems or comments...

PBIL Back to PBIL home page