(data stored in ACNUC7421 zone)

EMBL: CR954246.PE101

CR954246.PE101       Location/Qualifiers
FT   CDS_pept        complement(110165..110446)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0106"
FT                   /product="conserved protein of unknown function, possibly a
FT                   lipoprotein"
FT                   /function="5.2 : From other organisms"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0106"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85215"
FT                   /db_xref="InterPro:IPR018660"
FT                   /db_xref="InterPro:IPR036328"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IDJ7"
FT                   /protein_id="CAI85215.1"
FT                   /translation="MKALLIIALTVLGLSACNEPTINTRYLCNQKEATLSVINEQTAAL
FT                   TLNNNTYQLSREKSASGNKYINKNVLFWSKDSEAMLIIEGTKYHCLQQ"
     atgaaagcgc tgctgataat cgcattaact gtattaggct tatctgcttg taatgagccc        60
     acaattaaca ctcgttatct atgtaatcaa aaagaagcca cgcttagcgt tatcaatgag       120
     caaacagcag cactaacact taataataat acttatcagc ttagccgaga aaaaagcgcc       180
     tcaggtaata aatacataaa taaaaatgtg ttgttttgga gtaaagatag cgaagccatg       240
     cttattattg aagggacaaa ataccactgc ctacaacagt ag                          282
//

If you have problems or comments...

PBIL Back to PBIL home page