(data stored in ACNUC7421 zone)

EMBL: CR954246.PE102

CR954246.PE102       Location/Qualifiers
FT   CDS_pept        110587..111492
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0107"
FT                   /product="conserved protein of unknown function ; putative
FT                   membrane protein"
FT                   /function="5.2 : From other organisms"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function; Product type m : membrane component"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0107"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85216"
FT                   /db_xref="GOA:Q3IDJ6"
FT                   /db_xref="InterPro:IPR008526"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IDJ6"
FT                   /protein_id="CAI85216.1"
FT                   /translation="MAGTNLLTLLDDITVLLDDIATMSKVATKKTAGVLGDDLALNAQQ
FT                   VTGVAAERELPVVWAVAKGSFLNKAILVPAALLISVWLPWLITPLLMLGGLFLCFEGAE
FT                   KVFAKFLPHDDKSESEGDKLDLVEYEKQKVKGAIRTDFILSAEIIVITLGTVAAATLIN
FT                   QALVLCVIAIIMTIGVYGLVAGIVKLDDAGLYLLNQSKLSANKFKEILGKGLLAAAPRL
FT                   MQFLAFAGTVAMFLVGGGILVHGIKALHHIQIAVTNYGQTIVGTTGEVLAPLIFDGLLG
FT                   VIAGLVVVLGHLAYLKIFKK"
     atggcaggta ctaatctttt aaccttatta gacgacatta ctgtgctact agatgacatt        60
     gcaactatga gtaaagttgc tacaaaaaaa acagcgggtg tattaggtga tgacttagcg       120
     cttaatgctc aacaagttac cggtgtagct gcagagcgtg agctacctgt ggtgtgggcg       180
     gtagcaaaag gatcgttttt aaataaagca atattagtac ctgcggcgtt attaataagt       240
     gtgtggttac cttggttaat tacgccttta ttaatgttag gtggattatt tttatgtttt       300
     gagggcgcag aaaaagtatt tgccaagttt ttgcctcatg atgataaaag cgaaagtgag       360
     ggcgacaaat tagacctagt agaatacgag aagcaaaaag ttaaaggtgc gattagaacc       420
     gactttatac tttctgctga gatcatagta attacgcttg gcacagttgc agctgctaca       480
     ttaataaatc aggcattggt attgtgtgtt attgccataa ttatgactat tggcgtttat       540
     ggcttagttg caggaattgt gaagcttgat gatgcaggtc tatatttact taatcaatct       600
     aagctatcgg ctaataaatt taaagaaata ctaggcaaag ggttgttagc ggcagcacca       660
     cggcttatgc agtttttagc atttgcgggt acagttgcaa tgtttttagt gggcggcggc       720
     attttagtgc atggcattaa agctttgcat catattcaaa tagcggtaac caattatggg       780
     caaacaattg taggtactac aggtgaagtg ctggcaccac ttatatttga tggcttatta       840
     ggtgttatag caggcttagt tgttgtgctt gggcatttag cttatttaaa aatattcaaa       900
     aaatag                                                                  906
//

If you have problems or comments...

PBIL Back to PBIL home page