(data stored in ACNUC7421 zone)

EMBL: CR954246.PE103

CR954246.PE103       Location/Qualifiers
FT   CDS_pept        complement(111581..113656)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0108"
FT                   /product="putative TonB-dependent receptor; putative outer
FT                   membrane bound protein involved in iron chelated transport"
FT                   /function="1.2.4 : Cations"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homolgy; Product type t : transporter"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0108"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85217"
FT                   /db_xref="GOA:Q3IDJ5"
FT                   /db_xref="InterPro:IPR000531"
FT                   /db_xref="InterPro:IPR010105"
FT                   /db_xref="InterPro:IPR012910"
FT                   /db_xref="InterPro:IPR036942"
FT                   /db_xref="InterPro:IPR037066"
FT                   /db_xref="InterPro:IPR039423"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IDJ5"
FT                   /protein_id="CAI85217.1"
FT                   /translation="MKLSPLFIALLASTTASVYANATDIEHIEVKGSYFNDYKVDNANG
FT                   AMRTSASLLDTAQSVTVITDTIVNEQLATTLGEVLTNDASLTPGSKQRNREVFNLRGFE
FT                   LSSSTGYLRDGHQHWSHYQQPIEILQQVEVIKGPSSILYGQSGPGGLVNMVTKKPTSQT
FT                   LFKASADVDQHGSTRFMLDAGGALTESEDLRARGILVKQDVDYWREYQNGENRERDRFL
FT                   GALIVDYDISDNALVRVHYDRTDDEAGLDTGAWIDSNANVIGDDKTIRDMSWAFTDITV
FT                   ENLGVDLEVFLTENWQVKLGYNEQTFERQRFESAPRKPSNFIEGDSYASRPYDRFDDWQ
FT                   FKTAFVDFIGEFETFGIQHQFLIGANSLDYYYGQLKTNAESFDFSAGQNEPFRPAISYK
FT                   TDDTVSSSAYDYYGIYMQDLISFSPEWQLSLGGRYDKQSKENSNNESFVPKVGVLYHPN
FT                   ASATIYASYSEGFEPQNETLVNTNDVNNGMKLDAITSEQKEIGIKWQLFDDRLMLSGAL
FT                   FDISKTGTLVSEDLVNPVDNITSITTQAGEQRHKGFELAAQGAATDRLFVMASTMYLDA
FT                   NYERDATLQGKRPTDAPKWSASLWTRYELNDVIALNAGAFYEGERFADNANTVTKDAYT
FT                   RVDVGATYKINLNNTDVNLRLNIENLFDTNYLAGGGLNNVTIGEGASVRLAAQFSF"
     atgaaactaa gcccactttt tatcgcactg ctagcaagta ctactgcgag tgtttatgca        60
     aacgcaacag atatagaaca tatagaagta aaaggaagtt attttaatga ctataaagta       120
     gacaatgcta atggcgcaat gagaacgtca gcttcgttac ttgataccgc acagtcggtt       180
     accgttatta ccgacaccat agtaaatgaa caactcgcaa ctacgttagg tgaagtactt       240
     actaacgatg ccagcttaac gccaggttca aagcaacgta accgtgaagt atttaattta       300
     cgtgggtttg aactgagttc atctacaggt tacttgcgtg acggccatca gcactggtcg       360
     cactaccaac aacctatcga aatattacaa caagttgaag ttattaaagg cccatcaagt       420
     attttatatg gccaatcggg tcctggtggc ttggttaata tggtcactaa aaaacccacg       480
     tcacaaacat tatttaaagc cagtgccgat gttgatcaac atggttcaac tcgctttatg       540
     ctggatgcgg gcggtgcact tactgagtcg gaagatttac gtgctcgcgg tattttagta       600
     aagcaagatg ttgattattg gcgtgaatac caaaatggtg aaaaccgtga acgcgatcgc       660
     tttttaggtg cattaattgt tgattacgat attagcgata acgccttagt acgcgtacat       720
     tacgaccgca cagatgacga agccggttta gatacgggtg cctggattga tagtaatgcc       780
     aatgtaattg gcgacgataa aacaattcgc gatatgtctt gggcgtttac agatataacg       840
     gtagaaaacc taggtgttga cctagaagtg tttttaaccg aaaactggca agtaaaactt       900
     ggttacaacg agcaaacatt tgagcgtcaa cgctttgagt cagcacctcg taaaccaagt       960
     aactttatcg aaggtgatag ctacgcgtca cgcccttacg atcgttttga tgattggcag      1020
     tttaaaaccg cctttgttga ctttattggt gaatttgaaa cctttggtat tcagcaccaa      1080
     tttttaattg gcgcaaattc gcttgattat tattatggcc aattaaaaac taatgccgaa      1140
     tcatttgact ttagcgccgg gcaaaacgaa ccatttcgcc cagctataag ctataaaaca      1200
     gatgacactg ttagctcatc tgcttatgac tattacggta tttacatgca agatctcatt      1260
     tcgttctcac cagaatggca gttatcttta ggcggtcgtt acgacaagca aagtaaagaa      1320
     aatagtaata atgaatcgtt tgttcctaaa gtgggtgtgc tatatcaccc taatgcctcg      1380
     gccactattt acgctagtta ctctgaaggt tttgagccgc aaaacgaaac gctagtaaat      1440
     acaaacgatg ttaataatgg catgaagctc gatgcgatta cctctgagca aaaagaaatt      1500
     ggtattaaat ggcagctgtt tgacgatcga ttaatgctca gtggcgcatt atttgatatt      1560
     agcaaaacag gcactttagt gagcgaagat cttgtaaacc ctgttgataa tataaccagc      1620
     atcactactc aagctggcga gcagcgccat aaaggctttg aattagcggc gcaaggtgca      1680
     gcaactgatc gcttatttgt aatggcatca actatgtact tagatgccaa ctacgagcgc      1740
     gacgcaacat tgcaaggtaa gcgccctacc gatgccccta aatggtctgc atcactttgg      1800
     acgcgttatg aattaaacga cgtaattgca ttaaacgcag gtgcatttta cgaaggcgaa      1860
     cgctttgccg acaatgccaa taccgttact aaagatgcct acacccgcgt agatgtgggt      1920
     gcaacgtata aaataaactt aaacaatacc gacgttaact tacgcctaaa tattgaaaac      1980
     ttatttgata caaactacct agcaggcggt ggtttaaata atgtaaccat aggtgaaggc      2040
     gcgagcgtac gcttagcagc acaatttagc ttttaa                                2076
//

If you have problems or comments...

PBIL Back to PBIL home page