(data stored in ACNUC7421 zone)

EMBL: CR954246.PE105

CR954246.PE105       Location/Qualifiers
FT   CDS_pept        complement(115260..115787)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0110"
FT                   /product="putative DnaJ-class molecular chaperone"
FT                   /function="5.2 : From other organisms"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homolgy; Product type mc : molecular chaperone"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0110"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85219"
FT                   /db_xref="InterPro:IPR001623"
FT                   /db_xref="InterPro:IPR021059"
FT                   /db_xref="InterPro:IPR036869"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IDJ3"
FT                   /protein_id="CAI85219.1"
FT                   /translation="MVHTLAAELQQRKMINTLDVAPDRDLFKRNFLIMNALYQLQQQIM
FT                   PKQQLLISGLQIQLITTASNTLIKNTDPLRDYYLDWQNFETSSAEIDTLLTQFWQRFTK
FT                   HSKSAQIIDLDTHKQLLIKWQLSQQSTLKEVQKRWRQLALQCHPDKAVGNAEKFKQLKG
FT                   EYEQLRASCSVD"
     atggtacata ctttagcagc agaattacaa caacgtaaaa tgattaacac gcttgatgtt        60
     gcccctgatc gtgatttatt caaacgtaac tttttaatta tgaacgcgct ttatcagcta       120
     cagcagcaaa ttatgcctaa gcagcaactc cttattagtg gtttacaaat acaacttatt       180
     accacagcca gtaacactct cataaaaaac accgatccgc tacgagacta ctaccttgat       240
     tggcaaaact ttgaaacctc tagcgccgaa atcgatactc ttttaaccca gttttggcag       300
     cgttttacca aacacagtaa atctgcacaa ataatagatc tagacactca taaacagcta       360
     ttaataaagt ggcaactatc tcagcaaagc acgctaaaag aagtacaaaa gcgttggcgg       420
     caactggcgt tacagtgtca cccagataaa gcagttggta atgcagaaaa atttaaacag       480
     ttaaagggtg aatatgagca gcttagggca agctgctcag tagattag                    528
//

If you have problems or comments...

PBIL Back to PBIL home page