(data stored in ACNUC7421 zone)

EMBL: CR954246.PE106

CR954246.PE106       Location/Qualifiers
FT   CDS_pept        115918..118746
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0111"
FT                   /product="putative membrane bound sensor or esterase"
FT                   /function="5.2 : From other organisms"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homolgy"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0111"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85220"
FT                   /db_xref="GOA:Q3IDJ2"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR008207"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036641"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IDJ2"
FT                   /protein_id="CAI85220.1"
FT                   /translation="MQGWLQRFFFVGFMAVCSIFSTLSFSVTPADLFEQFKSAESWSDK
FT                   QSFASTLLTKKNLPHQQRIAIYSDLAELAFNANDLPHALEYYKLLESSITFNELPDLYF
FT                   RAIKMQGVVLYYQGFVQQAVVDYSRALGLAIRLKGSLKQANLLSNIGLAYFDMYNMELA
FT                   LDYYQQAKLIYEKEGSAQDKADILHNIAGIYIRLSRYESALEMYREVLKVFQQLGDEDG
FT                   VAQVYGNMGVAYTESKQYQLALHYNQLALRYYQSINNAFQLSTKHANLASINLHLNKFD
FT                   VALYHAKAAQQFALDAGNKSLLAAALHVLATAQFAQGDIENAKTTSEHSIALAKEYKNG
FT                   MRIKDGLGIEALIYSSLGDFKQALQLHQQYVDYQRSINTEEASKAVSIFQTQFEADKLN
FT                   QEIKQLKQQQHLQQLEISKRSQLTILLGIVAILILITVIAIYRRRIESNAKLQLTEQVE
FT                   QRTLELQSVAQELREANDVKSQFLANISHEIRTPLTAILSQTDDLINGLYDPEQLQDEL
FT                   KVIQRQSEHLKSLINDVLDLSKIEANRLELSISCFDIVQVLNDIHGMFSVQAKAKNLSL
FT                   VFDNQLGDELYTRLDLTRVKQILINLCANAIKFTHSGQVTIVANNTEQGLVLTVKDTGI
FT                   GMNTAQLKLIFECFSQADNSISRRFGGTGLGLSLSQQLAAMMGGYISVQSEFKKGSQFS
FT                   FFVPCVPVDKSECAVTAKDNINGDYKALSAKVLLAEDHDDNRRLISRYLRAMGLDVIAV
FT                   ENGEQAVEQCLKEYPDFVLLDIQMPIMDGITAFELLRQCGYEQPIFALTANAMSHEIEQ
FT                   YLALGFTDYLAKPIDKEKFYSTIAEHLASIKNEQNSTSVNIDMSDLVTSFKQSLSIESE
FT                   LISQHFNSGDFVALQKDSHRILGAAQMFKLCDIADAAKALDDACKSPEEVQNIAVLVDK
FT                   LQALFLHYKEHG"
     atgcagggtt ggttacaacg cttctttttt gttggcttta tggctgtatg cagcattttt        60
     tctacattga gtttttctgt tacaccagcc gacttatttg aacaatttaa gtctgctgaa       120
     agttggtcag ataaacaaag ctttgcctct acactgttaa ctaaaaaaaa cttaccacac       180
     caacagcgca ttgctatata tagcgactta gctgaacttg cctttaatgc caacgacctt       240
     ccccatgcct tagagtatta taagttatta gagagtagca tcacctttaa tgagttgccc       300
     gatctgtatt ttagagcaat aaaaatgcaa ggtgtggtgt tgtattatca agggtttgta       360
     caacaagctg tggttgatta tagccgggct ttagggttag ccatacgttt aaaaggctca       420
     ttaaaacaag ccaatttatt aagtaatata ggcttggctt attttgatat gtataacatg       480
     gaattagcac tagattatta tcagcaagca aaactgatct acgaaaaaga gggcagtgcg       540
     caagacaaag ccgatatttt gcacaatatt gccgggatat atattcgcct ttctcgttac       600
     gaatcagcac ttgaaatgta tcgtgaggta ttaaaggtat ttcaacaact tggtgatgaa       660
     gatggtgtag ctcaagtcta tggcaatatg ggagtagcct atactgagtc aaagcaatac       720
     cagttggcac tgcattataa tcagctggca ctgcgttact atcagagcat aaataatgca       780
     ttccaactct ctactaagca cgctaattta gcgagtatta atctgcactt aaataaattt       840
     gatgtggcct tatatcatgc aaaggcggcg cagcaatttg cacttgatgc agggaataaa       900
     tcgttattag cggcagcact gcatgtgctt gccactgcgc agtttgctca gggcgatatt       960
     gaaaatgcaa aaacaacgtc agagcactca attgcattag caaaagaata taaaaatggc      1020
     atgcgcatta aagacggctt aggtattgag gctttgattt actcaagctt aggcgacttt      1080
     aaacaagcgc tgcaattgca tcagcagtat gttgactatc aacgtagtat aaatacagaa      1140
     gaggcttcaa aggcagttag tatttttcaa actcaatttg aagcagataa actaaaccaa      1200
     gaaattaaac agctaaaaca acaacaacac ttacaacaac tggaaatatc taaacgttca      1260
     cagttaacta ttctgcttgg cattgtagca atccttattt taattacagt aatagcaatt      1320
     taccgtcgca gaatagaaag taatgcaaaa ttacaactaa cagagcaagt agagcaacgc      1380
     acgttagaat tacaaagtgt ggcgcaagag ctgcgcgaag caaacgatgt taaaagtcag      1440
     tttttagcaa atataagcca tgaaattcgc accccactca ccgctatttt aagccaaacc      1500
     gacgacttaa ttaatggttt gtatgatcct gagcagttac aagatgagct caaagttatt      1560
     cagcgtcaaa gcgagcattt aaaaagttta attaatgatg tgctcgattt aagtaaaata      1620
     gaagcaaaca gattggagct gtctatttct tgttttgata ttgtacaagt gctgaatgac      1680
     atacatggga tgtttagcgt acaagcaaaa gctaaaaact tatctttggt atttgacaac      1740
     caactcggtg atgaactgta taccaggctt gatttaactc gagtaaagca aatattaata      1800
     aacctgtgtg ctaatgcaat taaatttact cacagtggcc aagttacgat tgtggccaat      1860
     aataccgagc aagggctagt gctcacggta aaagataccg gaataggtat gaatacagcg      1920
     caacttaagc ttatttttga atgctttagc caagcagata atagtattag ccgtcgtttt      1980
     ggtggtactg gtttggggct tagtttgtca caacaactag ctgccatgat gggaggatat      2040
     attagtgtgc aaagcgaatt taaaaaaggc agtcaattct cattttttgt gccgtgcgta      2100
     ccagtagata aaagcgaatg tgcagttaca gctaaagaca atataaatgg tgactataaa      2160
     gcgctaagcg ctaaagtgtt acttgctgag gatcatgacg ataatcgcag attaataagc      2220
     cgttatttac gcgccatggg gcttgacgtt attgcagttg aaaatggcga gcaagctgta      2280
     gagcaatgtt taaaagagta tcctgatttt gtgctgttag acattcaaat gcctattatg      2340
     gatggcatta ctgcttttga gttgctcagg cagtgcggtt atgagcagcc aatatttgcc      2400
     ttaacggcca atgcaatgag ccatgagatc gagcagtatt tagcacttgg ttttactgat      2460
     tacttagcta aaccaattga taaagagaag ttttatagca ctatagctga gcatctcgca      2520
     tcaataaaaa atgagcaaaa cagcacaagc gtaaatatag atatgagtga cttagtgact      2580
     agtttcaaac aaagcttatc aatagaaagt gagttaatta gccagcactt taatagtggc      2640
     gactttgttg cgttacaaaa agatagccat cgtattttag gggcagcaca aatgtttaag      2700
     ttgtgcgata ttgcagacgc tgcaaaagcg ttagatgatg cgtgtaaaag cccagaagaa      2760
     gtacaaaata ttgcagtgtt agttgataaa ctacaagcct tatttttgca ctacaaagag      2820
     catggttaa                                                              2829
//

If you have problems or comments...

PBIL Back to PBIL home page