(data stored in ACNUC7421 zone)

EMBL: CR954246.PE111

CR954246.PE111       Location/Qualifiers
FT   CDS_pept        complement(129336..131405)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0121"
FT                   /product="conserved protein of unknown function ; putative
FT                   acetyltransferase domain"
FT                   /function="5.2 : From other organisms"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0121"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85225"
FT                   /db_xref="GOA:Q3IDD4"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR007807"
FT                   /db_xref="InterPro:IPR013562"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="InterPro:IPR024914"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032672"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IDD4"
FT                   /protein_id="CAI85225.1"
FT                   /translation="MQDYKLYKKQLIQLEQQLAGAHHRQLVLVTGNDNWCYELTNSLVQ
FT                   NTNTLTLSKHCALKNAQWPAHIHQILGQEFTHAIYDGFSGLYPDKLAAIAGTVRAGGVL
FT                   FVLLPELGNLNNWQDPALKSVQSHGHSNQYSLFNQRFSSIIKSLPALHYSEEFGCINNN
FT                   YNYVLHSNIDFEPQKNCVAQIVKVAHGRANRPLLINADRGRGKSAALGLAAAKLADKNV
FT                   IICATQFRATHSSFKHLAAQLNVNYDPLQKQLANMQYIAPDALLNELPECDVLLVDEAA
FT                   AIPVPMLLSMLAHYPRIVFASTLVGYEGNGRGYTIRFSQYIKNHYKASKVITLDEPLRF
FT                   AKHDPLEQHIRSLLALDAQYQETNSNKSQIPKHSEVTQQQLVTDEALLCQVVALLALAH
FT                   YQSSVNDLRQLLDAPSQRIFISKIDKQLVGVCLIAIEGGLSEELTEQVISGERRPQGHL
FT                   MAQTLAQLSFNSDFLTHLSARVVRIAIDPSSHNCGLGKALLSYSESQVKEQCTWFGASF
FT                   GATAQLLKFWQSLGFNAVKLGYQRDKSTAEHATLVVKSLNAPQQSLQSLIKQFQYELFY
FT                   GLLSHFKSLEWQLVSTLLRSFNDEVIASDTLRLFTQQLSSNRFTISPTLWRLISQSPAA
FT                   MTKLASNQQQLLIQTVLQHHTDEQLIKNLNLNGKKQLEQQFRNTTNILAKQLSS"
     atgcaagact acaagctata taaaaagcaa ctcatacaac tagaacaaca attagctggc        60
     gcgcatcacc gccagctagt gcttgttact ggcaatgata attggtgcta tgagctgaca       120
     aactcactag tacaaaatac taatacactt actctatcta aacattgtgc acttaaaaat       180
     gctcaatggc ctgcacacat tcaccaaata ttaggacaag aatttaccca cgccatttac       240
     gatggcttta gtggcttata ccccgataag ttggccgcaa ttgctggtac agttagagct       300
     ggcggagtat tgtttgtatt acttcctgag ctgggtaacc taaataactg gcaagatccc       360
     gcattaaaaa gtgtccagtc tcatggccac agcaatcaat atagtttatt caatcagcgt       420
     ttcagctcta ttattaaaag cttaccggcc ttgcattaca gtgaagaatt tggctgcatc       480
     aataataatt ataactatgt cctgcacagt aatattgatt ttgaaccgca gaaaaactgc       540
     gtagcacaaa tagtaaaagt agctcatggt cgcgccaata gaccgctact gatcaatgca       600
     gatagaggcc gaggaaagtc agccgcatta ggcctagcag ccgcaaaatt agctgataaa       660
     aatgtaatta tttgcgccac tcaatttaga gcaacacaca gcagctttaa acacttagct       720
     gcacagctaa atgttaatta cgatccatta caaaaacagc ttgctaacat gcaatatatt       780
     gcgccagacg ctctgttaaa tgagcttccc gagtgtgacg tactcttagt agatgaagct       840
     gctgctatcc cagtgcctat gttattaagc atgttagcgc attatcctcg tattgtattt       900
     gcaagcacct tagtaggtta tgaaggcaat ggtagaggct atacaattcg ctttagtcaa       960
     tatattaaaa accactacaa agcttctaaa gtaattactc ttgatgagcc attgcgcttt      1020
     gctaagcacg atccacttga gcagcatatt cgcagtttat tagcacttga tgcacagtat      1080
     caagagacta atagcaataa atcgcagatt cctaagcata gtgaagtaac tcagcaacaa      1140
     ctcgtaactg atgaagcact attgtgccaa gtcgttgctt tacttgcact tgctcattat      1200
     caaagtagtg tgaatgattt acgccagttg ttagatgcgc catcgcaacg catatttatc      1260
     agcaaaatag acaagcaatt agtgggtgta tgcttaatcg cgatagaagg cggtttaagt      1320
     gaagaactta ctgagcaagt tataagtggt gagcgccgcc cacaagggca tttaatggcg      1380
     caaacacttg cacaactgag ctttaacagt gattttttaa ctcatttaag tgcgcgagtt      1440
     gtccgtattg caattgatcc aagctcacat aattgtggcc taggaaaagc attactgagc      1500
     tatagcgagt cacaagtaaa agaacaatgt acttggtttg gtgctagttt tggtgccact      1560
     gcacaattgc taaaattttg gcaaagccta ggctttaatg ctgttaaatt aggttaccaa      1620
     cgcgacaaaa gcactgctga gcacgcaact ttagttgtta aatctcttaa tgcaccacaa      1680
     caaagtttac agtcactgat taaacagttt caatacgagc tgttttatgg cctattaagc      1740
     cactttaagt cattagaatg gcaactggtt agcacattac tgcgctcatt taatgatgag      1800
     gtaatagctt ctgatacgtt aaggttattt acacagcaac tcagcagtaa ccgctttact      1860
     atttcaccca ctctctggcg tttaattagc caaagccctg ctgcaatgac taagttagca      1920
     agcaatcagc aacaactttt aattcaaaca gtcttacaac atcataccga tgagcaactt      1980
     attaaaaatt taaatctcaa cggcaaaaag caattagaac aacagtttag aaacacaaca      2040
     aacatactcg caaagcaact ttcttcataa                                       2070
//

If you have problems or comments...

PBIL Back to PBIL home page