(data stored in ACNUC7421 zone)

EMBL: CR954246.PE114

CR954246.PE114       Location/Qualifiers
FT   CDS_pept        134118..134564
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0124"
FT                   /product="conserved protein of unknown function (similar to
FT                   E. coli YacL)"
FT                   /function="5.2 : From other organisms"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0124"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85228"
FT                   /db_xref="InterPro:IPR008249"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IDG3"
FT                   /protein_id="CAI85228.1"
FT                   /translation="MALFCFLASAAIYVYNCATNDLKAIRMEYQFIRDPISGLRIKISS
FT                   EHAIIGRWLNEEIGKDKIAMVQALIASVSSSFEPLTLKGQEIDLILTKDEALFEAHALH
FT                   QDSEDLMAYQDDDLMLEENGLSSGCGFEDFIDLINSWHEFTTSR"
     ttggcgctat tttgcttttt agcgtctgca gctatttacg tatataattg cgcaactaac        60
     gatttaaaag cgatacgtat ggaatatcaa tttattcgcg atccaattag cggattacgc       120
     attaaaataa gtagcgagca tgccataatt ggccgctggt taaacgaaga aataggcaaa       180
     gataaaatag ctatggtgca agcgcttatt gcatcggtga gttcaagctt tgagccttta       240
     acgctaaagg gccaagaaat agatttaatt ttaacgaaag acgaagctct atttgaagcc       300
     catgctctgc accaagacag tgaagatctt atggcttatc aagacgacga tttaatgctt       360
     gaagaaaatg gcctaagcag tggttgtggt tttgaagatt ttatagacct aataaactca       420
     tggcatgagt ttacgacttc aagataa                                           447
//

If you have problems or comments...

PBIL Back to PBIL home page