(data stored in ACNUC7421 zone)

EMBL: CR954246.PE115

CR954246.PE115       Location/Qualifiers
FT   CDS_pept        134671..135294
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0125"
FT                   /product="conserved protein of unknown function"
FT                   /function="5.2 : From other organisms"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0125"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85229"
FT                   /db_xref="InterPro:IPR014871"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IDG2"
FT                   /protein_id="CAI85229.1"
FT                   /translation="MSANLNKLVVMLEMQNAMNTKVHDQWFSQGFDWYRAIWVECAEML
FT                   DHYGWKWWKKQTPDTEQVILELVDIFHFGLSLRIDGITSYEKIAKQLELELSTAHQADD
FT                   FKQTLEVLAASAVADKTFNAAAFAGCMAQIGMNIDDLYRGYVGKNTLNFFRQDHGYKDG
FT                   SYIKVWGGQEDNEHLVEVVKSLNTEHADFAKLVYEGLEARYPTK"
     atgtctgcca atttaaacaa actagtagtg atgctagaaa tgcaaaatgc catgaatacc        60
     aaagtacatg accaatggtt tagccaaggg tttgattggt acagagccat ttgggttgag       120
     tgtgcagaaa tgctcgatca ttacggttgg aaatggtgga aaaaacaaac gcctgatacc       180
     gaacaagtta ttttagagtt agtggatatt tttcattttg gcttgtcact cagaattgac       240
     ggtatcacca gctacgaaaa aatagctaaa cagcttgagc tagaattaag cactgcccat       300
     caagccgatg actttaagca aacactggaa gtattggcgg catctgctgt cgcagataaa       360
     acttttaatg cggctgcttt tgcaggttgt atggcgcaaa taggtatgaa tattgacgat       420
     ttataccgag gttatgtggg taaaaacacc ttaaacttct tccgtcaaga tcatggctat       480
     aaagatggca gttacataaa agtgtggggc ggccaagaag ataacgagca tttagtagaa       540
     gttgttaaaa gccttaatac cgaacatgca gattttgcaa aattagtgta cgaaggctta       600
     gaggcacgat acccaacaaa atag                                              624
//

If you have problems or comments...

PBIL Back to PBIL home page