(data stored in ACNUC7421 zone)

EMBL: CR954246.PE116

CR954246.PE116       Location/Qualifiers
FT   CDS_pept        complement(135310..135957)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0126"
FT                   /product="putative hydrolase, contains a phosphatase-like
FT                   domain"
FT                   /function="5.2 : From other organisms"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homolgy; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0126"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85230"
FT                   /db_xref="GOA:Q3IDG1"
FT                   /db_xref="InterPro:IPR006439"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="InterPro:IPR041492"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IDG1"
FT                   /protein_id="CAI85230.1"
FT                   /translation="MLNWSKIDTVLLDMDGTLLDLHYDSHFWLNVIPQQHALAKNISFE
FT                   AAQADISKRYQAVSGKIQWYCSDYWEQQLNLPIMELKRQSKHLIKVRDDVPYFLTELKK
FT                   AGKELILLTNAHPECVMLKFEQTAIDNYLDGVVSTHEYGVSKEQQSLWQQVQSDLGFNK
FT                   SRTLFVDDSVPVLNAARQYGIEHLLAVANPDSQQPHNDIADYLNVTDYRKLI"
     atgctaaatt ggtcaaaaat cgatacagtt ttactcgata tggatggaac attactcgat        60
     ttacattacg atagccattt ttggcttaac gttattccac aacagcacgc attagcaaaa       120
     aatattagct ttgaagcagc gcaagctgat atttcaaaac gctaccaagc cgttagcgga       180
     aaaatacaat ggtactgctc agattattgg gagcaacagt taaacctgcc tattatggaa       240
     ctaaagcgac agtctaagca cttaataaaa gtgcgcgacg atgtgccgta ctttttaact       300
     gaacttaaaa aagcaggtaa agagttaatt ttacttacta acgcccaccc tgagtgtgta       360
     atgcttaaat ttgagcaaac tgcaattgat aactacttag atggagtcgt atcgactcat       420
     gaatatgggg taagtaaaga gcagcaaagc ttatggcaac aggtgcaaag tgacttagga       480
     tttaataaaa gccgtacgct ttttgttgat gatagtgttc ctgtgctcaa cgcagcacgc       540
     caatacggta ttgaacactt gcttgcggtt gctaacccag acagccaaca accacataac       600
     gatatagccg attacttaaa tgttaccgac tatcgcaagc taatttaa                    648
//

If you have problems or comments...

PBIL Back to PBIL home page