(data stored in ACNUC7421 zone)

EMBL: CR954246.PE118

CR954246.PE118       Location/Qualifiers
FT   CDS_pept        136585..137370
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0128"
FT                   /product="carbohydrate phosphatase; putative CysQ protein
FT                   duplicate"
FT                   /function="2.1.3.1 : Carbohydrates (other than glucose)"
FT                   /function="2.7 : Metabolism of phosphate"
FT                   /note="Evidence 2b : Function of strongly homologous gene;
FT                   Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0128"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85232"
FT                   /db_xref="GOA:Q3IDF9"
FT                   /db_xref="InterPro:IPR000760"
FT                   /db_xref="InterPro:IPR006240"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IDF9"
FT                   /protein_id="CAI85232.1"
FT                   /translation="MNKLLEPCILLAERAGDAIMAIYKNGDIGKEQKLDNTPVTKADLA
FT                   ANDVLVAGLEALAPNIPIMSEETPIPALADRQHWQRYWLLDPMDGTGEFILESGDFAVN
FT                   IALIENNQPVLGVIHWPTKGVTYFASADNGAFKRKNGSDKQIFVASPDNLTVAVSRRQK
FT                   IEAVSQYLNAQFTTVALGSCSLKACIVAEGKADCFLRIGPTGEWDTGASQIIVEQAGGS
FT                   ITDAEFNPLTYNQRESTENPDFIVMGHPDWEWQKMINPH"
     atgaataaat tactagagcc ttgtatatta ttggctgagc gtgctggtga tgccattatg        60
     gctatttata aaaatggtga tattggcaaa gagcaaaagc tagacaacac accagttact       120
     aaagctgatc ttgctgctaa cgacgtactt gtggctggtt tagaggcatt agcacccaat       180
     attcctatta tgtcagaaga aacaccgatc ccagcattag ccgataggca gcattggcaa       240
     cgttattggt tacttgatcc tatggatggt accggagaat ttattttaga aagtggcgac       300
     tttgcggtaa atatagcact cattgagaat aaccaacctg tgctgggagt tattcattgg       360
     ccaacaaaag gggtaaccta ttttgcgagc gccgataatg gggcatttaa gcgtaaaaat       420
     ggtagcgata agcaaatatt tgtagcctca cccgataact taacggttgc agtgagccgc       480
     cgccaaaaaa ttgaagcagt gagccagtac cttaacgccc aatttactac cgttgcttta       540
     gggtcatgct ctttaaaggc atgtattgta gcagaaggaa aggctgactg ttttttaaga       600
     ataggcccca ctggtgagtg ggatacgggc gcatcacaaa ttatagttga gcaagctggc       660
     ggcagtatta ccgatgcaga gtttaaccca ctaacttata atcagcgtga aagcactgaa       720
     aatccagact tcattgtaat ggggcaccct gattgggagt ggcaaaaaat gattaaccca       780
     cattaa                                                                  786
//

If you have problems or comments...

PBIL Back to PBIL home page