(data stored in ACNUC7421 zone)

EMBL: CR954246.PE119

CR954246.PE119       Location/Qualifiers
FT   CDS_pept        138548..139162
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0129"
FT                   /product="putative membrane protein"
FT                   /function="5.2 : From other organisms"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homolgy; Product type m : membrane component"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0129"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85233"
FT                   /db_xref="GOA:Q3IDF7"
FT                   /db_xref="InterPro:IPR005115"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IDF7"
FT                   /protein_id="CAI85233.1"
FT                   /translation="MTELYHWFDLIGVAVFAISGTLVAYEKKMDGFGVVVLATVTAIGG
FT                   GTVRDVILNVPVFWLHDQSYFAAILAAILLTTRLINKQRTIPHYNLQIADAFGLAFFAV
FT                   MGTQKALLAGMPDMTAVIMGVITGCFGGLIRDVLAREIPMLLKGELYATTCIAGGIVYT
FT                   LCINFSLIVEVAMILSMLMTLLLRFAAIKWGIVLHVFKYPD"
     atgacagaac tttaccactg gtttgatcta ataggtgttg cagtatttgc catatcgggc        60
     accttggtag cgtatgaaaa gaagatggat ggctttggtg ttgttgtact tgctaccgta       120
     accgctatcg gcggaggaac tgttcgcgat gtgatattaa atgttccggt attttggctg       180
     cacgaccaaa gttattttgc tgcaatttta gctgcaatat tactaacaac gcgactaata       240
     aataagcaaa gaaccatacc ccactataac ttacaaattg ccgatgcgtt tggtttagct       300
     ttttttgccg tgatgggcac acaaaaagca ttgcttgccg gtatgccaga tatgacagca       360
     gtgattatgg gggttattac tggatgtttt ggtggcctaa ttcgtgatgt acttgcccga       420
     gagatcccca tgctgttaaa gggcgagctt tatgcaacca cctgtatagc agggggaata       480
     gtgtacacct tgtgtattaa cttttcgctt atcgttgaag ttgcgatgat tttgagtatg       540
     ttgatgactc tattactgcg ttttgcagcc ataaaatggg gtattgtatt acacgttttt       600
     aaatatcccg actaa                                                        615
//

If you have problems or comments...

PBIL Back to PBIL home page